Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   LSAJ54_RS06755 Genome accession   NZ_LT960790
Coordinates   1342069..1342374 (-) Length   101 a.a.
NCBI ID   WP_011374997.1    Uniprot ID   Q38W27
Organism   Latilactobacillus sakei strain J54     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1337069..1347374
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LSAJ54_RS10305 (LSAJ54_1361) - 1337254..1337382 (+) 129 WP_231953078.1 TraX family protein -
  LSAJ54_RS06720 (LSAJ54_1362) - 1337508..1337873 (+) 366 WP_011374991.1 DUF805 domain-containing protein -
  LSAJ54_RS06730 (LSAJ54_1364) - 1338416..1338874 (-) 459 WP_096584650.1 laaL -
  LSAJ54_RS06735 (LSAJ54_1365) - 1338929..1340125 (-) 1197 WP_096584647.1 acetate/propionate family kinase -
  LSAJ54_RS06740 (LSAJ54_1366) - 1340147..1341157 (-) 1011 WP_025016388.1 class I SAM-dependent methyltransferase -
  LSAJ54_RS06745 (LSAJ54_1367) - 1341281..1341619 (-) 339 WP_056947123.1 hypothetical protein -
  LSAJ54_RS06750 (LSAJ54_1368) comGF 1341582..1342094 (-) 513 WP_035145013.1 competence type IV pilus minor pilin ComGF Machinery gene
  LSAJ54_RS06755 (LSAJ54_1369) comGE 1342069..1342374 (-) 306 WP_011374997.1 hypothetical protein Machinery gene
  LSAJ54_RS06760 (LSAJ54_1370) comGD 1342361..1342813 (-) 453 WP_035145016.1 competence type IV pilus minor pilin ComGD Machinery gene
  LSAJ54_RS06765 (LSAJ54_1371) comGC 1342785..1343084 (-) 300 WP_011374999.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  LSAJ54_RS06770 (LSAJ54_1372) comGB 1343081..1344088 (-) 1008 WP_056947133.1 type II secretion system F family protein Machinery gene
  LSAJ54_RS06775 (LSAJ54_1373) comGA 1344081..1344971 (-) 891 WP_099947399.1 competence type IV pilus ATPase ComGA Machinery gene
  LSAJ54_RS06780 (LSAJ54_1374) - 1345087..1345818 (-) 732 WP_076632059.1 YebC/PmpR family DNA-binding transcriptional regulator -
  LSAJ54_RS06785 (LSAJ54_1375) - 1345909..1346409 (-) 501 WP_076632058.1 VanZ family protein -
  LSAJ54_RS06790 (LSAJ54_1376) - 1346506..1346880 (+) 375 WP_099947400.1 hypothetical protein -

Sequence


Protein


Download         Length: 101 a.a.        Molecular weight: 11425.39 Da        Isoelectric Point: 11.1577

>NTDB_id=1148512 LSAJ54_RS06755 WP_011374997.1 1342069..1342374(-) (comGE) [Latilactobacillus sakei strain J54]
MFRSRPAFSLVENIIALTLVLGACWLLTVSLLHFKQQQTLKQQQVAQQAVLAMAAEQLRAHQTVKKRWQMGRTIYTVTAN
QQKLKVTTKAGESVAINWTTD

Nucleotide


Download         Length: 306 bp        

>NTDB_id=1148512 LSAJ54_RS06755 WP_011374997.1 1342069..1342374(-) (comGE) [Latilactobacillus sakei strain J54]
ATGTTCAGAAGTAGGCCGGCTTTTTCACTCGTTGAAAATATCATCGCCTTAACCTTAGTATTAGGGGCTTGCTGGCTATT
AACGGTAAGTCTACTACACTTTAAGCAACAACAAACGCTTAAACAACAGCAAGTTGCACAACAGGCGGTTCTAGCAATGG
CCGCTGAGCAGTTGAGAGCGCATCAGACAGTGAAAAAACGCTGGCAAATGGGGCGAACAATCTATACGGTGACGGCTAAT
CAGCAGAAATTAAAGGTAACCACAAAGGCAGGTGAGTCGGTTGCGATTAATTGGACGACCGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q38W27

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Latilactobacillus sakei subsp. sakei 23K

100

100

1


Multiple sequence alignment