Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | QU35_RS12805 | Genome accession | NZ_CP010052 |
| Coordinates | 2552457..2552630 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2547457..2557630
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QU35_RS12790 (QU35_13420) | gcvT | 2548256..2549344 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| QU35_RS12795 (QU35_13425) | hepAA | 2549786..2551459 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| QU35_RS12800 (QU35_13430) | yqhG | 2551480..2552274 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| QU35_RS12805 (QU35_13435) | sinI | 2552457..2552630 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| QU35_RS12810 (QU35_13440) | sinR | 2552664..2552999 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| QU35_RS12815 (QU35_13445) | tasA | 2553092..2553877 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| QU35_RS12820 (QU35_13450) | sipW | 2553941..2554513 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| QU35_RS12825 (QU35_13455) | tapA | 2554497..2555258 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| QU35_RS12830 (QU35_13460) | yqzG | 2555530..2555856 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| QU35_RS12835 (QU35_13465) | spoIITA | 2555898..2556077 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| QU35_RS12840 (QU35_13470) | comGG | 2556148..2556522 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| QU35_RS12845 (QU35_13475) | comGF | 2556523..2556906 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| QU35_RS12850 (QU35_13480) | comGE | 2556932..2557279 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=114758 QU35_RS12805 WP_003230187.1 2552457..2552630(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=114758 QU35_RS12805 WP_003230187.1 2552457..2552630(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |