Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   QU35_RS12805 Genome accession   NZ_CP010052
Coordinates   2552457..2552630 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2547457..2557630
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QU35_RS12790 (QU35_13420) gcvT 2548256..2549344 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  QU35_RS12795 (QU35_13425) hepAA 2549786..2551459 (+) 1674 WP_004398544.1 SNF2-related protein -
  QU35_RS12800 (QU35_13430) yqhG 2551480..2552274 (+) 795 WP_003230200.1 YqhG family protein -
  QU35_RS12805 (QU35_13435) sinI 2552457..2552630 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QU35_RS12810 (QU35_13440) sinR 2552664..2552999 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QU35_RS12815 (QU35_13445) tasA 2553092..2553877 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  QU35_RS12820 (QU35_13450) sipW 2553941..2554513 (-) 573 WP_003246088.1 signal peptidase I SipW -
  QU35_RS12825 (QU35_13455) tapA 2554497..2555258 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  QU35_RS12830 (QU35_13460) yqzG 2555530..2555856 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QU35_RS12835 (QU35_13465) spoIITA 2555898..2556077 (-) 180 WP_003230176.1 YqzE family protein -
  QU35_RS12840 (QU35_13470) comGG 2556148..2556522 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  QU35_RS12845 (QU35_13475) comGF 2556523..2556906 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  QU35_RS12850 (QU35_13480) comGE 2556932..2557279 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=114758 QU35_RS12805 WP_003230187.1 2552457..2552630(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=114758 QU35_RS12805 WP_003230187.1 2552457..2552630(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1