Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CKW02_RS15750 Genome accession   NZ_LT906438
Coordinates   2989817..2989957 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain NCTC10337     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2984817..2994957
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CKW02_RS15725 (SAMEA4076707_03211) - 2985152..2985541 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  CKW02_RS15730 (SAMEA4076707_03212) comA 2985565..2986206 (-) 642 WP_003213500.1 response regulator transcription factor Regulator
  CKW02_RS15735 (SAMEA4076707_03213) comP 2986287..2988578 (-) 2292 WP_003213749.1 ATP-binding protein Regulator
  CKW02_RS15740 (SAMEA4076707_03214) comX 2988585..2988764 (-) 180 WP_034620107.1 competence pheromone ComX -
  CKW02_RS15745 (SAMEA4076707_03215) - 2988742..2989665 (-) 924 WP_003212977.1 polyprenyl synthetase family protein -
  CKW02_RS15750 (SAMEA4076707_03216) degQ 2989817..2989957 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  CKW02_RS15755 (SAMEA4076707_03217) - 2990463..2990816 (+) 354 WP_034620108.1 hypothetical protein -
  CKW02_RS15760 (SAMEA4076707_03218) - 2990847..2992073 (-) 1227 WP_003212852.1 EAL and HDOD domain-containing protein -
  CKW02_RS15765 (SAMEA4076707_03219) - 2992213..2993682 (-) 1470 WP_003212630.1 nicotinate phosphoribosyltransferase -
  CKW02_RS15770 (SAMEA4076707_03220) - 2993700..2994251 (-) 552 WP_003213138.1 cysteine hydrolase family protein -
  CKW02_RS15775 (SAMEA4076707_03221) - 2994312..2994719 (-) 408 WP_003212896.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1147100 CKW02_RS15750 WP_003213123.1 2989817..2989957(-) (degQ) [Bacillus pumilus strain NCTC10337]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1147100 CKW02_RS15750 WP_003213123.1 2989817..2989957(-) (degQ) [Bacillus pumilus strain NCTC10337]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment