Detailed information
Overview
| Name | comB3 | Type | Machinery gene |
| Locus tag | CS888_RS02510 | Genome accession | NZ_LT635473 |
| Coordinates | 505096..505359 (-) | Length | 87 a.a. |
| NCBI ID | WP_001177718.1 | Uniprot ID | A0AAV3IH30 |
| Organism | Helicobacter pylori isolate HE136/09 | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 447000..528548 | 505096..505359 | within | 0 |
Gene organization within MGE regions
Location: 447000..528548
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CS888_RS02260 | - | 447856..450135 (-) | 2280 | WP_231899392.1 | DEAD/DEAH box helicase family protein | - |
| CS888_RS08380 | - | 450309..451000 (-) | 692 | Protein_432 | type I restriction endonuclease | - |
| CS888_RS02265 | - | 451048..452943 (-) | 1896 | WP_089086720.1 | motility associated factor glycosyltransferase family protein | - |
| CS888_RS02270 | - | 452968..453735 (-) | 768 | WP_089086721.1 | TerB family tellurite resistance protein | - |
| CS888_RS02275 | - | 453745..454059 (-) | 315 | WP_001878784.1 | hypothetical protein | - |
| CS888_RS02280 | - | 454061..455548 (-) | 1488 | WP_089086722.1 | DUF5644 domain-containing protein | - |
| CS888_RS02285 | - | 455560..456048 (-) | 489 | WP_089086723.1 | hypothetical protein | - |
| CS888_RS02290 | - | 456033..457769 (-) | 1737 | WP_089086724.1 | M3 family oligoendopeptidase | - |
| CS888_RS02295 | - | 457866..459116 (-) | 1251 | WP_000431942.1 | cation:proton antiporter | - |
| CS888_RS08385 | - | 459270..459452 (-) | 183 | Protein_440 | hypothetical protein | - |
| CS888_RS02305 | - | 459436..459996 (-) | 561 | WP_000595776.1 | outer membrane beta-barrel protein | - |
| CS888_RS02310 | modA | 460222..460962 (+) | 741 | WP_089086725.1 | molybdate ABC transporter substrate-binding protein | - |
| CS888_RS02315 | modB | 460985..461659 (+) | 675 | WP_000349430.1 | molybdate ABC transporter permease subunit | - |
| CS888_RS02320 | - | 461656..462453 (+) | 798 | WP_089086726.1 | ATP-binding cassette domain-containing protein | - |
| CS888_RS02325 | gltX | 462571..463962 (-) | 1392 | WP_089086727.1 | glutamate--tRNA ligase | - |
| CS888_RS02330 | hopJ | 464080..465192 (+) | 1113 | WP_089086728.1 | Hop family outer membrane protein HopJ/HopK | - |
| CS888_RS02335 | - | 465201..466838 (+) | 1638 | Protein_447 | TaqI-like C-terminal specificity domain-containing protein | - |
| CS888_RS02340 | - | 466804..467652 (+) | 849 | WP_089086729.1 | glycosyltransferase family 9 protein | - |
| CS888_RS02345 | typA | 467698..469497 (+) | 1800 | WP_000790195.1 | translational GTPase TypA | - |
| CS888_RS02350 | - | 469513..469910 (+) | 398 | Protein_450 | DNA adenine methylase | - |
| CS888_RS02355 | - | 470668..472701 (+) | 2034 | WP_089086730.1 | relaxase/mobilization nuclease domain-containing protein | - |
| CS888_RS02360 | - | 473854..474921 (+) | 1068 | Protein_452 | tyrosine-type recombinase/integrase | - |
| CS888_RS02365 | - | 475238..476041 (-) | 804 | WP_089086732.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| CS888_RS02370 | - | 476013..476264 (-) | 252 | WP_000006537.1 | hypothetical protein | - |
| CS888_RS02375 | - | 476396..477076 (-) | 681 | WP_001153463.1 | hypothetical protein | - |
| CS888_RS02380 | - | 477297..478310 (+) | 1014 | WP_089086733.1 | hypothetical protein | - |
| CS888_RS02385 | - | 478315..479591 (-) | 1277 | Protein_457 | hypothetical protein | - |
| CS888_RS02390 | - | 479588..480850 (-) | 1263 | WP_089086734.1 | type IV secretion system protein | - |
| CS888_RS02395 | - | 480847..482280 (-) | 1434 | WP_089086735.1 | hypothetical protein | - |
| CS888_RS02400 | - | 482290..484336 (-) | 2047 | Protein_460 | hypothetical protein | - |
| CS888_RS02405 | - | 484336..485388 (-) | 1053 | WP_089086736.1 | ArdC family protein | - |
| CS888_RS08275 | - | 485389..485553 (-) | 165 | WP_000189763.1 | hypothetical protein | - |
| CS888_RS02415 | - | 486191..486859 (+) | 669 | WP_089086737.1 | ParA family protein | - |
| CS888_RS02420 | - | 486906..487283 (+) | 378 | WP_000365707.1 | hypothetical protein | - |
| CS888_RS02425 | - | 487261..487926 (+) | 666 | WP_089086738.1 | hypothetical protein | - |
| CS888_RS02430 | - | 488000..488803 (-) | 804 | WP_089086739.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| CS888_RS02435 | - | 488773..489243 (-) | 471 | WP_000965788.1 | hypothetical protein | - |
| CS888_RS02440 | - | 489298..491358 (-) | 2061 | WP_001942503.1 | type IA DNA topoisomerase | - |
| CS888_RS02450 | - | 491379..493622 (-) | 2244 | Protein_469 | type IV secretory system conjugative DNA transfer family protein | - |
| CS888_RS02455 | - | 493619..493846 (-) | 228 | Protein_470 | replication regulatory RepB family protein | - |
| CS888_RS02460 | - | 493816..494700 (-) | 885 | WP_089086741.1 | ATPase, T2SS/T4P/T4SS family | - |
| CS888_RS02465 | - | 494705..494980 (-) | 276 | WP_089086742.1 | hypothetical protein | - |
| CS888_RS02470 | - | 494997..495959 (-) | 963 | WP_089086743.1 | hypothetical protein | - |
| CS888_RS02475 | - | 495972..498194 (-) | 2223 | WP_089086744.1 | RGS domain-containing GTPase-activating protein | - |
| CS888_RS02480 | comB10 | 498178..499383 (-) | 1206 | WP_089086745.1 | DNA type IV secretion system protein ComB10 | Machinery gene |
| CS888_RS02485 | - | 499380..501035 (-) | 1656 | WP_000617227.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| CS888_RS02490 | - | 501032..502168 (-) | 1137 | WP_089086746.1 | VirB8/TrbF family protein | - |
| CS888_RS08390 | - | 502161..502301 (-) | 141 | WP_000789928.1 | hypothetical protein | - |
| CS888_RS02500 | - | 502298..504848 (-) | 2551 | Protein_479 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| CS888_RS02505 | - | 504848..505084 (-) | 237 | WP_001168537.1 | hypothetical protein | - |
| CS888_RS02510 | comB3 | 505096..505359 (-) | 264 | WP_001177718.1 | hypothetical protein | Machinery gene |
| CS888_RS02515 | comB2 | 505371..505655 (-) | 285 | WP_000413637.1 | TrbC/VirB2 family protein | Machinery gene |
| CS888_RS02520 | - | 505643..506131 (-) | 489 | WP_089086747.1 | hypothetical protein | - |
| CS888_RS02525 | - | 506195..506353 (-) | 159 | WP_231899360.1 | hypothetical protein | - |
| CS888_RS02530 | - | 506356..507156 (-) | 801 | WP_089086748.1 | integrase | - |
| CS888_RS02535 | - | 507211..507747 (+) | 537 | Protein_486 | DNA adenine methylase | - |
| CS888_RS02540 | - | 507750..508373 (+) | 624 | WP_089086749.1 | GIY-YIG nuclease family protein | - |
| CS888_RS02545 | - | 508521..508883 (+) | 363 | Protein_488 | DNA cytosine methyltransferase | - |
| CS888_RS02550 | - | 509043..509987 (-) | 945 | WP_089086751.1 | catalase family peroxidase | - |
| CS888_RS02555 | hofC | 510274..511860 (+) | 1587 | WP_089086752.1 | outer membrane beta-barrel protein HofC | - |
| CS888_RS02560 | hofD | 511932..513329 (+) | 1398 | WP_089086753.1 | outer membrane beta-barrel protein HofD | - |
| CS888_RS02575 | - | 513647..516106 (+) | 2460 | WP_414842625.1 | DUF3519 domain-containing protein | - |
| CS888_RS02580 | - | 516116..516537 (+) | 422 | Protein_493 | hypothetical protein | - |
| CS888_RS02585 | - | 516534..517081 (+) | 548 | Protein_494 | hypothetical protein | - |
| CS888_RS02590 | - | 517321..518457 (-) | 1137 | WP_000461999.1 | potassium channel family protein | - |
| CS888_RS02600 | rpmB | 518644..518832 (-) | 189 | WP_001118998.1 | 50S ribosomal protein L28 | - |
| CS888_RS02605 | - | 518925..519764 (-) | 840 | WP_089086759.1 | HpaA family protein | - |
| CS888_RS02610 | mraY | 519895..520956 (+) | 1062 | WP_089087378.1 | phospho-N-acetylmuramoyl-pentapeptide- transferase | - |
| CS888_RS02615 | murD | 520958..522226 (+) | 1269 | WP_089086760.1 | UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase | - |
| CS888_RS02620 | - | 522223..522483 (-) | 261 | WP_089086761.1 | DUF493 family protein | - |
| CS888_RS02625 | - | 522473..522781 (-) | 309 | WP_089086762.1 | hotdog domain-containing protein | - |
| CS888_RS02630 | - | 523014..524342 (+) | 1329 | WP_000526620.1 | sodium-dependent transporter | - |
| CS888_RS02635 | - | 524353..525681 (+) | 1329 | WP_089086763.1 | sodium-dependent transporter | - |
| CS888_RS02640 | - | 525696..526763 (+) | 1068 | WP_099167462.1 | phospholipase A | - |
| CS888_RS02645 | dnaN | 526819..527943 (+) | 1125 | WP_089086764.1 | DNA polymerase III subunit beta | - |
Sequence
Protein
Download Length: 87 a.a. Molecular weight: 9988.86 Da Isoelectric Point: 5.7206
>NTDB_id=1145792 CS888_RS02510 WP_001177718.1 505096..505359(-) (comB3) [Helicobacter pylori isolate HE136/09]
MQLVGISVSNLKEISSKEKFLWLNAKSFLLSGFVPFIMMPWLDILNSFVLYVCFLLIFSIAEFFDEDISDILIAHSKIKT
KANSFYA
MQLVGISVSNLKEISSKEKFLWLNAKSFLLSGFVPFIMMPWLDILNSFVLYVCFLLIFSIAEFFDEDISDILIAHSKIKT
KANSFYA
Nucleotide
Download Length: 264 bp
>NTDB_id=1145792 CS888_RS02510 WP_001177718.1 505096..505359(-) (comB3) [Helicobacter pylori isolate HE136/09]
ATGCAATTAGTTGGTATTTCAGTTTCTAATCTCAAAGAAATCAGCTCCAAAGAAAAATTTCTTTGGCTCAATGCTAAGAG
TTTTTTACTCTCAGGATTTGTGCCTTTTATTATGATGCCTTGGCTAGATATATTGAACTCTTTTGTGCTTTATGTGTGCT
TTCTCTTAATTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGTGACATTTTAATCGCTCATTCCAAAATTAAAACC
AAAGCTAATTCATTTTATGCTTAA
ATGCAATTAGTTGGTATTTCAGTTTCTAATCTCAAAGAAATCAGCTCCAAAGAAAAATTTCTTTGGCTCAATGCTAAGAG
TTTTTTACTCTCAGGATTTGTGCCTTTTATTATGATGCCTTGGCTAGATATATTGAACTCTTTTGTGCTTTATGTGTGCT
TTCTCTTAATTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGTGACATTTTAATCGCTCATTCCAAAATTAAAACC
AAAGCTAATTCATTTTATGCTTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB3 | Helicobacter pylori 26695 |
60.92 |
100 |
0.609 |