Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BGLY_RS18620 Genome accession   NZ_LT603683
Coordinates   3613911..3614051 (-) Length   46 a.a.
NCBI ID   WP_046131692.1    Uniprot ID   -
Organism   Bacillus glycinifermentans isolate BGLY     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3608911..3619051
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BGLY_RS18595 (BGLY_3739) - 3609182..3609574 (-) 393 WP_046131688.1 hotdog fold thioesterase -
  BGLY_RS18600 (BGLY_3740) comA 3609594..3610232 (-) 639 WP_046131689.1 response regulator transcription factor Regulator
  BGLY_RS18605 (BGLY_3741) comP 3610315..3612633 (-) 2319 WP_065894683.1 ATP-binding protein Regulator
  BGLY_RS18610 (BGLY_3742) comX 3612674..3612838 (-) 165 WP_046131691.1 competence pheromone ComX -
  BGLY_RS18615 (BGLY_3743) - 3612849..3613721 (-) 873 WP_046131716.1 polyprenyl synthetase family protein -
  BGLY_RS18620 (BGLY_3744) degQ 3613911..3614051 (-) 141 WP_046131692.1 degradation enzyme regulation protein DegQ Regulator
  BGLY_RS18625 (BGLY_3745) - 3614544..3614891 (+) 348 WP_231947384.1 hypothetical protein -
  BGLY_RS18630 (BGLY_3746) - 3614942..3616159 (-) 1218 WP_046131693.1 EAL and HDOD domain-containing protein -
  BGLY_RS18635 (BGLY_3747) - 3616314..3617783 (-) 1470 WP_046131694.1 nicotinate phosphoribosyltransferase -
  BGLY_RS18640 (BGLY_3748) - 3617801..3618352 (-) 552 WP_046131695.1 cysteine hydrolase family protein -
  BGLY_RS18645 (BGLY_3749) - 3618490..3618882 (-) 393 WP_046131696.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5733.54 Da        Isoelectric Point: 8.4596

>NTDB_id=1145001 BGLY_RS18620 WP_046131692.1 3613911..3614051(-) (degQ) [Bacillus glycinifermentans isolate BGLY]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYSYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1145001 BGLY_RS18620 WP_046131692.1 3613911..3614051(-) (degQ) [Bacillus glycinifermentans isolate BGLY]
GTGGAAAAGCAACAAATTGAAGAGTTAAAGCAATTGCTTTGGCGGCTTGAAAATGAAATCAGGGAAACGAAAGACTCCTT
GCGCAAGATTAACAAAAGTATCGACCAATATGATAAATACTCATATTTAAAAACCTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment