Detailed information NTG1142045

Bioinformatically predicted

Overview

• Name: cipB
• Type: Regulator
• Locus tag: DQL01_RS02975
• Genome accession: NZ_LS483451
• Coordinates: 543345..543494 (+)
• Length: 49 a.a.
• NCBI ID: WP_001818346.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae strain 4041STDY6836166
• Function: indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IScluster/Tn	541755..542478	543345..543494	flank	867

Gene organization within MGE regions

Location: 541755..543494

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DQL01_RS02960	blpM	542628..542882 (+)	255	WP_111702462.1	two-peptide bacteriocin subunit BlpM	-
DQL01_RS02965	blpN	542898..543101 (+)	204	WP_001099492.1	two-peptide bacteriocin subunit BlpN	-
DQL01_RS02975	cipB	543345..543494 (+)	150	WP_001818346.1	bacteriocin-like peptide BlpO	Regulator

Sequence

Protein

• Length: 49 a.a.
• Molecular weight: 5134.91 Da
• Isoelectric Point: 3.9133

>NTDB_id=1142045 DQL01_RS02975 WP_001818346.1 543345..543494(+) (cipB) [Streptococcus pneumoniae strain 4041STDY6836166]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide

• Length: 150 bp

>NTDB_id=1142045 DQL01_RS02975 WP_001818346.1 543345..543494(+) (cipB) [Streptococcus pneumoniae strain 4041STDY6836166]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

• Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc) (6-44)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
cipB	Streptococcus mutans UA159	51.02	100	0.51