Detailed information    

insolico Bioinformatically predicted

Overview

Name   HI0659   Type   Machinery gene
Locus tag   DQL12_RS02945 Genome accession   NZ_LS483450
Coordinates   541289..541555 (+) Length   88 a.a.
NCBI ID   WP_001808618.1    Uniprot ID   A0A0E9GZQ4
Organism   Streptococcus pneumoniae strain 4041STDY6583227     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 527148..541555 541289..541555 within 0
IS/Tn 540760..540984 541289..541555 flank 305


Gene organization within MGE regions


Location: 527148..541555
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DQL12_RS12080 - 527148..527777 (+) 630 WP_224782241.1 hypothetical protein -
  DQL12_RS02890 licT 528077..528916 (+) 840 WP_000584538.1 BglG family transcription antiterminator LicT -
  DQL12_RS02895 - 528934..530772 (+) 1839 WP_050096473.1 beta-glucoside-specific PTS transporter subunit IIABC -
  DQL12_RS02900 - 530785..532200 (+) 1416 WP_000151832.1 glycoside hydrolase family 1 protein -
  DQL12_RS02905 pheS 532792..533838 (+) 1047 WP_001813261.1 phenylalanine--tRNA ligase subunit alpha -
  DQL12_RS02910 - 533838..534347 (+) 510 WP_000619941.1 GNAT family N-acetyltransferase -
  DQL12_RS02915 pheT 534424..536829 (+) 2406 WP_050255518.1 phenylalanine--tRNA ligase subunit beta -
  DQL12_RS02920 - 536897..537901 (-) 1005 WP_050227336.1 endonuclease/exonuclease/phosphatase family protein -
  DQL12_RS02925 - 537922..538605 (-) 684 WP_000743644.1 DUF6973 domain-containing protein -
  DQL12_RS02930 - 538877..539386 (-) 510 WP_001066469.1 hypothetical protein -
  DQL12_RS02935 - 539624..540505 (+) 882 WP_001267157.1 helix-turn-helix domain-containing protein -
  DQL12_RS02940 - 540760..541163 (+) 404 Protein_547 helix-turn-helix domain-containing protein -
  DQL12_RS02945 HI0659 541289..541555 (+) 267 WP_001808618.1 helix-turn-helix domain-containing protein Machinery gene

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9622.15 Da        Isoelectric Point: 4.4893

>NTDB_id=1141968 DQL12_RS02945 WP_001808618.1 541289..541555(+) (HI0659) [Streptococcus pneumoniae strain 4041STDY6583227]
MEGCPSELFSKEEILESDMRVAIMSELIEARYEQGISQKKLEEVSGISQPVIARMETGKTSPQLDTVLKVLASLGKTLAI
VPLEQGKS

Nucleotide


Download         Length: 267 bp        

>NTDB_id=1141968 DQL12_RS02945 WP_001808618.1 541289..541555(+) (HI0659) [Streptococcus pneumoniae strain 4041STDY6583227]
TTGGAAGGATGTCCATCTGAGCTCTTTAGCAAGGAGGAAATCCTTGAAAGTGATATGCGAGTGGCTATCATGAGCGAGTT
GATTGAGGCTAGGTATGAACAAGGAATCAGTCAGAAAAAGCTGGAAGAAGTCAGTGGAATAAGCCAGCCTGTCATAGCTA
GGATGGAGACAGGAAAGACTAGTCCTCAGTTGGATACAGTCTTAAAAGTCCTAGCCAGTTTAGGAAAGACACTAGCAATC
GTCCCACTTGAACAGGGAAAAAGTTGA

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(29-79)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A0E9GZQ4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  HI0659 Haemophilus influenzae Rd KW20

61.039

87.5

0.534

Multiple sequence alignment