Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   DQL12_RS02730 Genome accession   NZ_LS483450
Coordinates   502241..502390 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain 4041STDY6583227     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 500570..501374 502241..502390 flank 867


Gene organization within MGE regions


Location: 500570..502390
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DQL12_RS02710 - 500570..501374 (+) 805 WP_111695758.1 IS5 family transposase -
  DQL12_RS02715 blpM 501524..501778 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  DQL12_RS02720 blpN 501794..501997 (+) 204 WP_050255686.1 two-peptide bacteriocin subunit BlpN -
  DQL12_RS02730 cipB 502241..502390 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=1141967 DQL12_RS02730 WP_001818346.1 502241..502390(+) (cipB) [Streptococcus pneumoniae strain 4041STDY6583227]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=1141967 DQL12_RS02730 WP_001818346.1 502241..502390(+) (cipB) [Streptococcus pneumoniae strain 4041STDY6583227]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51

Multiple sequence alignment