Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   DQK99_RS02935 Genome accession   NZ_LS483448
Coordinates   536886..537035 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 4041STDY6836167     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 535214..536019 536886..537035 flank 867


Gene organization within MGE regions


Location: 535214..537035
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DQK99_RS02915 - 535214..536019 (+) 806 Protein_558 IS5 family transposase -
  DQK99_RS02920 blpM 536169..536423 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  DQK99_RS02925 blpN 536439..536642 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  DQK99_RS02935 cipB 536886..537035 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=1141812 DQK99_RS02935 WP_001809846.1 536886..537035(+) (cipB) [Streptococcus pneumoniae strain 4041STDY6836167]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=1141812 DQK99_RS02935 WP_001809846.1 536886..537035(+) (cipB) [Streptococcus pneumoniae strain 4041STDY6836167]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531

Multiple sequence alignment