Detailed information    

insolico Bioinformatically predicted

Overview


Name   pptA   Type   Regulator
Locus tag   DQN33_RS08090 Genome accession   NZ_LS483408
Coordinates   1620136..1620861 (-) Length   241 a.a.
NCBI ID   WP_100912206.1    Uniprot ID   -
Organism   Streptococcus uberis strain NCTC4674     
Function   export ComS (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1582953..1620861 1620136..1620861 within 0


Gene organization within MGE regions


Location: 1582953..1620861
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DQN33_RS07830 (NCTC4674_01660) - 1582953..1583198 (+) 246 WP_111673439.1 hypothetical protein -
  DQN33_RS07835 (NCTC4674_01661) - 1583301..1583777 (-) 477 WP_111673440.1 hypothetical protein -
  DQN33_RS07840 (NCTC4674_01662) - 1583779..1584066 (-) 288 WP_111673441.1 hypothetical protein -
  DQN33_RS10365 (NCTC4674_01663) - 1584310..1585026 (-) 717 WP_111673442.1 peptidoglycan amidohydrolase family protein -
  DQN33_RS07850 (NCTC4674_01664) - 1585029..1585493 (-) 465 WP_111673443.1 phage holin family protein -
  DQN33_RS07855 (NCTC4674_01665) - 1585506..1587563 (-) 2058 WP_111673444.1 hypothetical protein -
  DQN33_RS07860 (NCTC4674_01666) - 1587556..1589067 (-) 1512 WP_111673445.1 phage tail protein -
  DQN33_RS07865 (NCTC4674_01667) - 1589064..1589783 (-) 720 WP_111673446.1 hypothetical protein -
  DQN33_RS07870 (NCTC4674_01668) - 1589780..1593310 (-) 3531 WP_111673447.1 hypothetical protein -
  DQN33_RS07875 (NCTC4674_01669) - 1593325..1593954 (-) 630 WP_111673448.1 Gp15 family bacteriophage protein -
  DQN33_RS07880 (NCTC4674_01670) - 1593956..1594315 (-) 360 WP_111673449.1 hypothetical protein -
  DQN33_RS07885 (NCTC4674_01671) - 1594380..1594853 (-) 474 WP_111673450.1 phage tail tube protein -
  DQN33_RS07890 (NCTC4674_01672) - 1594846..1595253 (-) 408 WP_111673451.1 minor capsid protein -
  DQN33_RS07895 (NCTC4674_01673) - 1595250..1595642 (-) 393 WP_046388784.1 minor capsid protein -
  DQN33_RS10370 - 1595620..1595691 (-) 72 WP_367889853.1 hypothetical protein -
  DQN33_RS07900 (NCTC4674_01674) - 1595660..1595974 (-) 315 Protein_1493 putative minor capsid protein -
  DQN33_RS07905 (NCTC4674_01675) - 1595964..1596353 (-) 390 WP_111673452.1 hypothetical protein -
  DQN33_RS10180 (NCTC4674_01676) - 1596394..1596552 (-) 159 WP_155392446.1 hypothetical protein -
  DQN33_RS07910 (NCTC4674_01677) - 1596556..1596783 (-) 228 WP_111673453.1 hypothetical protein -
  DQN33_RS07915 (NCTC4674_01678) - 1596800..1597669 (-) 870 WP_111673454.1 capsid protein -
  DQN33_RS07920 (NCTC4674_01679) - 1597686..1598249 (-) 564 WP_111673455.1 phage scaffolding protein -
  DQN33_RS07925 (NCTC4674_01680) - 1598452..1598691 (-) 240 WP_111673456.1 16S rRNA processing protein RimM -
  DQN33_RS07935 (NCTC4674_01681) - 1598672..1600219 (-) 1548 WP_172455885.1 phage minor capsid protein -
  DQN33_RS07940 (NCTC4674_01682) - 1600226..1601728 (-) 1503 WP_331813061.1 phage portal protein -
  DQN33_RS07945 (NCTC4674_01683) - 1601738..1603030 (-) 1293 WP_415244972.1 PBSX family phage terminase large subunit -
  DQN33_RS07950 (NCTC4674_01684) terS 1603032..1603817 (-) 786 WP_197712546.1 phage terminase small subunit -
  DQN33_RS07955 (NCTC4674_01685) - 1603819..1604280 (-) 462 WP_111673458.1 DUF1492 domain-containing protein -
  DQN33_RS07960 (NCTC4674_01686) - 1604385..1604576 (-) 192 WP_006739436.1 hypothetical protein -
  DQN33_RS07965 (NCTC4674_01687) - 1604588..1604818 (-) 231 WP_111673459.1 hypothetical protein -
  DQN33_RS10185 (NCTC4674_01688) - 1604815..1604967 (-) 153 WP_172455886.1 hypothetical protein -
  DQN33_RS07970 (NCTC4674_01689) - 1605329..1606723 (-) 1395 WP_111673460.1 virulence-associated E family protein -
  DQN33_RS07975 (NCTC4674_01690) - 1606707..1607531 (-) 825 WP_111673461.1 bifunctional DNA primase/polymerase -
  DQN33_RS07980 (NCTC4674_01691) ssb 1607542..1607931 (-) 390 WP_111673462.1 single-stranded DNA-binding protein Machinery gene
  DQN33_RS07985 (NCTC4674_01693) - 1608013..1608720 (-) 708 WP_111673463.1 ERF family protein -
  DQN33_RS07990 (NCTC4674_01694) - 1608731..1609054 (-) 324 WP_111673464.1 hypothetical protein -
  DQN33_RS07995 (NCTC4674_01695) - 1609066..1610247 (-) 1182 WP_172455910.1 DEAD/DEAH box helicase family protein -
  DQN33_RS08000 (NCTC4674_01696) - 1610210..1610677 (-) 468 WP_111673465.1 hypothetical protein -
  DQN33_RS08005 (NCTC4674_01697) - 1610674..1611156 (-) 483 WP_111673466.1 siphovirus Gp157 family protein -
  DQN33_RS08010 (NCTC4674_01699) - 1611238..1611435 (-) 198 WP_145960784.1 hypothetical protein -
  DQN33_RS10190 (NCTC4674_01700) - 1611435..1611605 (-) 171 WP_172455887.1 hypothetical protein -
  DQN33_RS08015 (NCTC4674_01701) - 1611608..1611889 (-) 282 WP_111673468.1 DNA-binding protein -
  DQN33_RS08020 (NCTC4674_01702) - 1611955..1612158 (-) 204 WP_111673469.1 helix-turn-helix domain-containing protein -
  DQN33_RS08025 (NCTC4674_01703) - 1612290..1612454 (+) 165 WP_111673470.1 YjzC family protein -
  DQN33_RS08030 (NCTC4674_01704) - 1612599..1612814 (-) 216 WP_111673471.1 transcriptional regulator -
  DQN33_RS08035 (NCTC4674_01705) - 1612861..1613241 (+) 381 WP_111673472.1 DUF2513 domain-containing protein -
  DQN33_RS10195 (NCTC4674_01706) - 1613224..1613361 (-) 138 WP_172455888.1 hypothetical protein -
  DQN33_RS08040 (NCTC4674_01707) - 1613687..1614034 (+) 348 WP_046388814.1 helix-turn-helix domain-containing protein -
  DQN33_RS08045 (NCTC4674_01708) - 1614038..1614424 (+) 387 WP_111673473.1 ImmA/IrrE family metallo-endopeptidase -
  DQN33_RS08050 (NCTC4674_01709) - 1614452..1615375 (+) 924 WP_111673474.1 hypothetical protein -
  DQN33_RS08055 (NCTC4674_01710) - 1615386..1615730 (+) 345 WP_111673475.1 STAS-like domain-containing protein -
  DQN33_RS08060 (NCTC4674_01711) - 1615720..1616244 (+) 525 WP_111673476.1 type II toxin-antitoxin system VapC family toxin -
  DQN33_RS08065 (NCTC4674_01712) - 1616367..1617434 (+) 1068 WP_111673477.1 tyrosine-type recombinase/integrase -
  DQN33_RS08075 (NCTC4674_01714) trmB 1617613..1618248 (-) 636 WP_015911783.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -
  DQN33_RS08080 (NCTC4674_01715) ccrZ 1618248..1619039 (-) 792 WP_015911784.1 cell cycle regulator CcrZ -
  DQN33_RS08085 (NCTC4674_01716) - 1619100..1620134 (-) 1035 WP_111673478.1 ABC transporter permease -
  DQN33_RS08090 (NCTC4674_01717) pptA 1620136..1620861 (-) 726 WP_100912206.1 ABC transporter ATP-binding protein Regulator

Sequence


Protein


Download         Length: 241 a.a.        Molecular weight: 26977.46 Da        Isoelectric Point: 4.9159

>NTDB_id=1140521 DQN33_RS08090 WP_100912206.1 1620136..1620861(-) (pptA) [Streptococcus uberis strain NCTC4674]
MLKIENLTGGYLNIPVLKNISFTIEDGELVGLIGLNGAGKSTTIKEIIGLLKPYNGEITIDGLSIEQDNQNYRKKIGFIP
ETPSLYEELTLKEHIEITAMAYDIPVEKALQRAESLLETYRLSDKLDWFPSLFSKGMKQKVMIICAFIIDPSLFILDEPF
LGLDPLAISDLVAHLEEEKKKGKSILMSTHVLDSAEKMCDRFIILHKGQIKAQGTLEELRKSFGQSGASLNDIYLMLTKE
V

Nucleotide


Download         Length: 726 bp        

>NTDB_id=1140521 DQN33_RS08090 WP_100912206.1 1620136..1620861(-) (pptA) [Streptococcus uberis strain NCTC4674]
ATGCTAAAAATTGAAAATCTTACAGGCGGTTACCTTAATATTCCAGTGTTAAAAAATATTTCTTTTACAATAGAAGATGG
AGAACTAGTTGGCCTAATTGGTTTAAATGGTGCCGGGAAATCAACAACCATTAAAGAAATCATTGGCTTATTAAAACCTT
ATAATGGGGAAATAACAATTGATGGCCTTAGTATAGAACAAGATAATCAAAACTATAGGAAAAAAATTGGTTTTATTCCC
GAAACGCCAAGTTTATATGAGGAATTAACCCTTAAAGAACATATTGAAATTACAGCAATGGCCTATGATATCCCTGTTGA
GAAGGCCTTACAAAGAGCTGAAAGTTTATTAGAAACGTATCGCCTTTCGGATAAATTGGATTGGTTTCCAAGCCTGTTTT
CTAAAGGGATGAAACAAAAAGTGATGATTATTTGTGCCTTCATTATTGATCCTAGTCTCTTTATATTAGATGAACCCTTT
TTAGGACTAGATCCTTTAGCTATTTCAGATTTGGTTGCACATTTAGAAGAAGAAAAAAAGAAGGGCAAGTCCATTTTAAT
GAGTACTCATGTTTTAGATTCTGCTGAAAAAATGTGTGACCGTTTCATTATTCTTCATAAGGGACAGATTAAAGCTCAAG
GAACACTTGAAGAGCTAAGAAAAAGCTTTGGACAGTCAGGTGCTAGCTTAAATGATATCTACCTAATGTTAACAAAAGAG
GTTTAA

Domains


Predicted by InterproScan.

(17-160)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pptA Streptococcus thermophilus LMD-9

72.803

99.17

0.722

  pptA Streptococcus salivarius strain HSISS4

72.803

99.17

0.722


Multiple sequence alignment