Detailed information    

insolico Bioinformatically predicted

Overview


Name   rcrR   Type   Regulator
Locus tag   DQN23_RS05165 Genome accession   NZ_LS483403
Coordinates   1011040..1011480 (-) Length   146 a.a.
NCBI ID   WP_111712857.1    Uniprot ID   -
Organism   Streptococcus lutetiensis strain NCTC13774     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1003920..1024847 1011040..1011480 within 0


Gene organization within MGE regions


Location: 1003920..1024847
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DQN23_RS05135 (NCTC13774_01073) - 1003920..1004765 (+) 846 WP_061407966.1 aldo/keto reductase -
  DQN23_RS05140 (NCTC13774_01074) - 1004807..1006033 (-) 1227 WP_020916920.1 HAMP domain-containing sensor histidine kinase -
  DQN23_RS05145 (NCTC13774_01075) - 1006042..1006722 (-) 681 WP_020916921.1 response regulator transcription factor -
  DQN23_RS05150 (NCTC13774_01076) - 1006725..1007360 (-) 636 WP_020916922.1 GTP pyrophosphokinase family protein -
  DQN23_RS05155 (NCTC13774_01077) rcrQ 1007460..1009232 (-) 1773 WP_020916923.1 ABC transporter ATP-binding protein Regulator
  DQN23_RS05160 (NCTC13774_01078) rcrP 1009222..1011036 (-) 1815 WP_020916924.1 ABC transporter ATP-binding protein Regulator
  DQN23_RS05165 (NCTC13774_01079) rcrR 1011040..1011480 (-) 441 WP_111712857.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  DQN23_RS05170 (NCTC13774_01080) - 1011625..1012035 (-) 411 WP_111712858.1 peptide deformylase -
  DQN23_RS09285 - 1012032..1012244 (-) 213 WP_228380533.1 GNAT family N-acetyltransferase -
  DQN23_RS09290 (NCTC13774_01081) - 1012226..1012540 (-) 315 WP_233422855.1 hypothetical protein -
  DQN23_RS05180 (NCTC13774_01082) gdhA 1012698..1014047 (-) 1350 WP_043895060.1 NADP-specific glutamate dehydrogenase -
  DQN23_RS05185 (NCTC13774_01083) - 1014284..1014781 (+) 498 WP_111712859.1 HdeD family acid-resistance protein -
  DQN23_RS05190 (NCTC13774_01084) queF 1014818..1015309 (-) 492 WP_058814005.1 preQ(1) synthase -
  DQN23_RS05195 queE 1015459..1016178 (-) 720 Protein_959 7-carboxy-7-deazaguanine synthase QueE -
  DQN23_RS05200 (NCTC13774_01087) queD 1016171..1016617 (-) 447 WP_111712860.1 6-carboxytetrahydropterin synthase QueD -
  DQN23_RS05205 (NCTC13774_01088) queC 1016617..1017270 (-) 654 Protein_961 7-cyano-7-deazaguanine synthase QueC -
  DQN23_RS05210 (NCTC13774_01090) - 1017435..1019204 (-) 1770 WP_020916931.1 ABC transporter ATP-binding protein -
  DQN23_RS05215 (NCTC13774_01091) - 1019207..1020946 (-) 1740 WP_020916932.1 ABC transporter ATP-binding protein -
  DQN23_RS05220 (NCTC13774_01092) - 1021054..1021749 (-) 696 WP_111712861.1 hypothetical protein -
  DQN23_RS05225 (NCTC13774_01093) - 1021777..1023645 (-) 1869 WP_111712862.1 ABC-F family ATP-binding cassette domain-containing protein -
  DQN23_RS05230 (NCTC13774_01094) - 1023642..1024847 (-) 1206 WP_020916935.1 CCA tRNA nucleotidyltransferase -

Sequence


Protein


Download         Length: 146 a.a.        Molecular weight: 16994.56 Da        Isoelectric Point: 9.6897

>NTDB_id=1140355 DQN23_RS05165 WP_111712857.1 1011040..1011480(-) (rcrR) [Streptococcus lutetiensis strain NCTC13774]
MRDKDLFSQFRYFINLMENRVHELGGQHGVENLAGPQGFAVLYLRENEDKEVFIKDIERKLKISKSVTSNLIKRMEKNGF
IEVVPSEVDKRYKRVVLTELGKAKSKGIDAFHTAIHKQIFDGISREELEISGRVFDRILKNLENKE

Nucleotide


Download         Length: 441 bp        

>NTDB_id=1140355 DQN23_RS05165 WP_111712857.1 1011040..1011480(-) (rcrR) [Streptococcus lutetiensis strain NCTC13774]
ATGCGAGACAAAGATTTGTTTTCACAATTTAGATACTTTATTAATTTGATGGAGAATCGGGTACATGAGCTCGGTGGGCA
GCATGGTGTTGAAAATCTCGCTGGTCCGCAGGGATTTGCAGTTCTTTATTTACGTGAGAATGAAGACAAAGAAGTTTTCA
TCAAGGACATTGAACGTAAGCTTAAGATTTCAAAATCTGTGACCAGTAATTTGATTAAACGAATGGAGAAGAATGGCTTT
ATTGAGGTGGTTCCGTCGGAGGTTGATAAGCGTTATAAGCGTGTCGTCTTGACTGAGCTGGGTAAAGCAAAATCCAAAGG
CATCGATGCTTTTCATACTGCTATTCATAAGCAAATTTTTGATGGTATTAGCCGTGAAGAGCTAGAAATTTCTGGTCGTG
TTTTTGATCGTATTTTGAAAAACTTAGAAAACAAGGAGTAA

Domains


Predicted by InterproScan.

(35-91)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrR Streptococcus mutans UA159

53.846

97.945

0.527


Multiple sequence alignment