Detailed information    

insolico Bioinformatically predicted

Overview


Name   comC/blpC   Type   Regulator
Locus tag   DQM59_RS01565 Genome accession   NZ_LS483349
Coordinates   298390..298536 (-) Length   48 a.a.
NCBI ID   WP_002280232.1    Uniprot ID   Q1WBZ0
Organism   Streptococcus mutans strain NCTC10449     
Function   binding to ComD; induce autophosphorylation of ComD; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context


Location: 293390..303536
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DQM59_RS01545 (NCTC10449_00294) - 294387..295013 (+) 627 WP_002265453.1 hypothetical protein -
  DQM59_RS01550 (NCTC10449_00295) - 295060..295698 (+) 639 WP_002265117.1 VTT domain-containing protein -
  DQM59_RS01555 (NCTC10449_00296) comE/blpR 296179..296931 (+) 753 WP_002280234.1 response regulator transcription factor Regulator
  DQM59_RS01560 (NCTC10449_00297) comD/blpH 296928..298253 (+) 1326 WP_002280233.1 sensor histidine kinase Regulator
  DQM59_RS01565 (NCTC10449_00298) comC/blpC 298390..298536 (-) 147 WP_002280232.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  DQM59_RS01570 (NCTC10449_00299) - 298803..299024 (+) 222 WP_002312090.1 Blp family class II bacteriocin -
  DQM59_RS01575 (NCTC10449_00300) - 299055..299273 (+) 219 WP_025985888.1 Blp family class II bacteriocin -
  DQM59_RS01580 (NCTC10449_00301) - 299359..299763 (+) 405 WP_002280427.1 hypothetical protein -
  DQM59_RS10460 - 299886..300098 (-) 213 Protein_277 IS3 family transposase -
  DQM59_RS01595 (NCTC10449_00303) - 300538..300702 (+) 165 WP_002265308.1 hypothetical protein -
  DQM59_RS01605 (NCTC10449_00304) - 301086..301277 (+) 192 WP_002312088.1 Blp family class II bacteriocin -
  DQM59_RS01610 (NCTC10449_00305) - 301441..301629 (+) 189 WP_002280338.1 Blp family class II bacteriocin -
  DQM59_RS01615 (NCTC10449_00306) - 302114..303142 (+) 1029 WP_002280337.1 thioredoxin family protein -

Sequence


Protein


Download         Length: 48 a.a.        Molecular weight: 5464.37 Da        Isoelectric Point: 10.7837

>NTDB_id=1137869 DQM59_RS01565 WP_002280232.1 298390..298536(-) (comC/blpC) [Streptococcus mutans strain NCTC10449]
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGKIR

Nucleotide


Download         Length: 147 bp        

>NTDB_id=1137869 DQM59_RS01565 WP_002280232.1 298390..298536(-) (comC/blpC) [Streptococcus mutans strain NCTC10449]
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAAACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGGAAAATAAGATAG

Domains


Predicted by InterproScan.

(1-32)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q1WBZ0

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/blpC Streptococcus mutans UA159

97.826

95.833

0.937


Multiple sequence alignment