Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilJ   Type   Machinery gene
Locus tag   MORIYA_RS21445 Genome accession   NZ_LS483250
Coordinates   3243285..3243443 (+) Length   52 a.a.
NCBI ID   WP_269461246.1    Uniprot ID   -
Organism   Moritella yayanosii strain DB21MT 5     
Function   type IV pilus biogenesis and function (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3238285..3248443
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MORIYA_RS15035 (MORIYA_3173) lexA 3240761..3241384 (+) 624 WP_112716412.1 transcriptional repressor LexA -
  MORIYA_RS15040 (MORIYA_3174) - 3241730..3242091 (+) 362 Protein_2899 response regulator -
  MORIYA_RS15045 (MORIYA_3175) - 3242094..3242846 (+) 753 WP_232011639.1 Hpt domain-containing protein -
  MORIYA_RS21440 (MORIYA_3177) - 3243113..3243250 (+) 138 WP_232011640.1 hypothetical protein -
  MORIYA_RS21445 (MORIYA_3178) pilJ 3243285..3243443 (+) 159 WP_269461246.1 methyl-accepting chemotaxis protein Machinery gene
  MORIYA_RS21450 (MORIYA_3180) - 3243587..3243766 (+) 180 WP_232011641.1 hypothetical protein -
  MORIYA_RS15055 (MORIYA_3181) - 3243898..3245028 (+) 1131 WP_112716414.1 S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase -
  MORIYA_RS15060 (MORIYA_3182) fghA 3245084..3245929 (+) 846 WP_112716416.1 S-formylglutathione hydrolase -
  MORIYA_RS15065 (MORIYA_3183) trmL 3245988..3246452 (-) 465 WP_006030983.1 tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL -
  MORIYA_RS15070 (MORIYA_3184) - 3246532..3246768 (+) 237 WP_112716418.1 hypothetical protein -
  MORIYA_RS15075 (MORIYA_3185) - 3246803..3248095 (-) 1293 WP_174216934.1 ATP-binding protein -

Sequence

Protein


Download         Length: 52 a.a.        Molecular weight: 5428.18 Da        Isoelectric Point: 4.2645

>NTDB_id=1135276 MORIYA_RS21445 WP_269461246.1 3243285..3243443(+) (pilJ) [Moritella yayanosii strain DB21MT 5]
MNNINGLVDNAQKIASQTNLLSLNAAIEAALAGEMGRGFAVVAQEIRLLSDT

Nucleotide


Download         Length: 159 bp        

>NTDB_id=1135276 MORIYA_RS21445 WP_269461246.1 3243285..3243443(+) (pilJ) [Moritella yayanosii strain DB21MT 5]
ATGAATAATATTAATGGGCTTGTTGATAATGCACAGAAAATCGCTAGTCAAACTAATTTACTTTCCTTGAATGCCGCCAT
TGAAGCGGCTCTGGCTGGTGAGATGGGTCGTGGTTTTGCCGTTGTAGCACAAGAAATTCGATTATTATCGGATACTTAA

Domains

Predicted by InterproScan.

Methyl-accepting chemotaxis protein (MCP) signalling domain (MCPsignal)

(2-50)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilJ Synechocystis sp. PCC 6803

69.231

75

0.519

Multiple sequence alignment