Detailed information    

insolico Bioinformatically predicted

Overview


Name   sepM   Type   Regulator
Locus tag   H1W92_RS07760 Genome accession   NZ_LR822039
Coordinates   1475317..1476393 (-) Length   358 a.a.
NCBI ID   WP_011226464.1    Uniprot ID   -
Organism   Streptococcus thermophilus isolate STH_CIRM_1116     
Function   processing of CSP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1454387..1537517 1475317..1476393 within 0


Gene organization within MGE regions


Location: 1454387..1537517
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H1W92_RS07655 (STHERMO_1668) gatA 1455653..1457119 (-) 1467 WP_002946584.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA -
  H1W92_RS07660 (STHERMO_1669) gatC 1457119..1457421 (-) 303 WP_002884769.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC -
  H1W92_RS07665 (STHERMO_1670) - 1457561..1457815 (-) 255 WP_011226449.1 glycosyl transferase -
  H1W92_RS07670 (STHERMO_1671) - 1457828..1458037 (-) 210 WP_011226450.1 glycosyltransferase -
  H1W92_RS07675 - 1458353..1459794 (-) 1442 Protein_1452 6-phospho-beta-glucosidase -
  H1W92_RS07680 (STHERMO_1674) msrA 1459947..1460456 (-) 510 WP_002946589.1 peptide-methionine (S)-S-oxide reductase MsrA -
  H1W92_RS07685 (STHERMO_1675) - 1460468..1461316 (-) 849 WP_041828318.1 MetQ/NlpA family ABC transporter substrate-binding protein -
  H1W92_RS07690 (STHERMO_1676) - 1461439..1461990 (-) 552 WP_002946999.1 cysteine hydrolase family protein -
  H1W92_RS07695 (STHERMO_1677) codY 1462053..1462838 (-) 786 WP_002951720.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  H1W92_RS07700 (STHERMO_1678) - 1463098..1464312 (-) 1215 WP_011226456.1 pyridoxal phosphate-dependent aminotransferase -
  H1W92_RS07705 (STHERMO_1679) - 1464693..1465145 (+) 453 WP_002946987.1 universal stress protein -
  H1W92_RS07710 - 1465325..1465896 (+) 572 Protein_1459 IS30 family transposase -
  H1W92_RS07715 (STHERMO_1683) - 1466112..1466582 (-) 471 WP_011227497.1 membrane protein -
  H1W92_RS07720 (STHERMO_1685) pflA 1466788..1467588 (-) 801 WP_002946980.1 pyruvate formate-lyase-activating protein -
  H1W92_RS07725 - 1467776..1467886 (-) 111 WP_014621906.1 LPXTG cell wall anchor domain-containing protein -
  H1W92_RS07730 (STHERMO_1687) - 1468584..1469915 (-) 1332 WP_002951727.1 hemolysin family protein -
  H1W92_RS07735 (STHERMO_1688) - 1470028..1470810 (+) 783 WP_011226459.1 ABC transporter ATP-binding protein -
  H1W92_RS07740 (STHERMO_1690) - 1471429..1473495 (-) 2067 WP_011227498.1 cation:proton antiporter -
  H1W92_RS07745 (STHERMO_1691) - 1473504..1473746 (-) 243 WP_011227499.1 hypothetical protein -
  H1W92_RS07750 (STHERMO_1692) - 1473743..1474291 (-) 549 WP_004197152.1 tRNA (mnm(5)s(2)U34)-methyltransferase -
  H1W92_RS07755 (STHERMO_1693) - 1474288..1475232 (-) 945 WP_011226463.1 TIGR01212 family radical SAM protein -
  H1W92_RS07760 (STHERMO_1694) sepM 1475317..1476393 (-) 1077 WP_011226464.1 SepM family pheromone-processing serine protease Regulator
  H1W92_RS07765 (STHERMO_1695) coaD 1476371..1476868 (-) 498 WP_011226465.1 pantetheine-phosphate adenylyltransferase -
  H1W92_RS07770 (STHERMO_1696) rsmD 1476902..1477501 (-) 600 WP_011227500.1 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  H1W92_RS07775 (STHERMO_1697) trxB 1477592..1478545 (-) 954 WP_255136104.1 thioredoxin-disulfide reductase -
  H1W92_RS07780 (STHERMO_1698) - 1478578..1478802 (-) 225 WP_011226468.1 DUF4059 family protein -
  H1W92_RS07785 (STHERMO_1699) - 1479017..1479760 (-) 744 WP_011226469.1 amino acid ABC transporter ATP-binding protein -
  H1W92_RS07790 (STHERMO_1700) - 1479760..1480506 (-) 747 WP_095559509.1 amino acid ABC transporter permease -
  H1W92_RS07795 (STHERMO_1701) - 1480895..1481722 (-) 828 WP_041827091.1 transporter substrate-binding domain-containing protein -
  H1W92_RS07800 (STHERMO_1702) - 1482303..1482536 (-) 234 WP_002947030.1 hypothetical protein -
  H1W92_RS07805 (STHERMO_1703) dinB 1482822..1483925 (-) 1104 WP_011227504.1 DNA polymerase IV -
  H1W92_RS07810 (STHERMO_1704) pflB 1484203..1486512 (+) 2310 WP_011226473.1 formate C-acetyltransferase -
  H1W92_RS07815 (STHERMO_1705) - 1486779..1487561 (+) 783 Protein_1480 carbonic anhydrase -
  H1W92_RS07820 - 1487612..1488065 (+) 454 Protein_1481 GNAT family N-acetyltransferase -
  H1W92_RS07825 (STHERMO_1708) - 1488399..1488722 (-) 324 WP_011227507.1 restriction endonuclease subunit S -
  H1W92_RS10240 mobV 1488747..1489255 (-) 509 Protein_1483 MobV family relaxase -
  H1W92_RS07835 (STHERMO_1713) - 1489735..1490329 (-) 595 Protein_1484 site-specific integrase -
  H1W92_RS07840 (STHERMO_1714) - 1490417..1491103 (-) 687 WP_011227510.1 hypothetical protein -
  H1W92_RS07845 (STHERMO_1715) - 1491179..1491934 (-) 756 WP_002951770.1 ABC transporter permease -
  H1W92_RS07850 (STHERMO_1716) - 1491931..1492581 (-) 651 WP_022096490.1 ATP-binding cassette domain-containing protein -
  H1W92_RS07855 (STHERMO_1718) - 1492783..1493739 (-) 957 WP_002951776.1 serine hydrolase domain-containing protein -
  H1W92_RS07860 (STHERMO_1719) - 1493739..1494494 (-) 756 WP_011681560.1 CppA family protein -
  H1W92_RS07865 (STHERMO_1720) - 1494847..1495800 (+) 954 WP_041826943.1 IS30 family transposase -
  H1W92_RS07870 (STHERMO_1721) - 1496021..1496296 (+) 276 WP_224103608.1 CPBP family intramembrane glutamic endopeptidase -
  H1W92_RS07875 (STHERMO_1722) gla 1496470..1497333 (-) 864 WP_002951781.1 aquaglyceroporin Gla -
  H1W92_RS07880 (STHERMO_1723) - 1497454..1499721 (+) 2268 WP_011227515.1 Xaa-Pro dipeptidyl-peptidase -
  H1W92_RS07885 - 1500164..1501554 (+) 1391 Protein_1494 IS3-like element ISSth1b family transposase -
  H1W92_RS07890 (STHERMO_1727) - 1501700..1501942 (-) 243 WP_011227518.1 Blp family class II bacteriocin -
  H1W92_RS07895 (STHERMO_1728) - 1502192..1502923 (+) 732 WP_002948869.1 LytR/AlgR family response regulator transcription factor -
  H1W92_RS09955 - 1503460..1504263 (+) 804 WP_224103634.1 ATP-binding protein -
  H1W92_RS07905 (STHERMO_1730) - 1504281..1504442 (-) 162 WP_011226496.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  H1W92_RS07910 - 1504457..1505825 (-) 1369 Protein_1499 bacteriocin secretion accessory protein -
  H1W92_RS07915 (STHERMO_1735) comA/nlmT 1505841..1507994 (-) 2154 WP_059257386.1 peptide cleavage/export ABC transporter Regulator
  H1W92_RS07920 (STHERMO_1738) - 1509008..1510753 (-) 1746 WP_011226501.1 ABC transporter ATP-binding protein -
  H1W92_RS07925 (STHERMO_1739) - 1510746..1512503 (-) 1758 WP_011226502.1 ABC transporter ATP-binding protein -
  H1W92_RS09960 (STHERMO_1741) - 1512691..1512897 (-) 207 WP_002948879.1 hypothetical protein -
  H1W92_RS07935 (STHERMO_1742) - 1513102..1513629 (-) 528 WP_011227521.1 VanZ family protein -
  H1W92_RS07940 (STHERMO_1743) rlmN 1513631..1514800 (-) 1170 WP_011227522.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  H1W92_RS07945 (STHERMO_1744) - 1514804..1515526 (-) 723 WP_011226505.1 YutD family protein -
  H1W92_RS07950 (STHERMO_1745) - 1515581..1516936 (-) 1356 WP_059257451.1 bifunctional metallophosphatase/5'-nucleotidase -
  H1W92_RS07955 (STHERMO_1748) - 1517784..1519127 (-) 1344 WP_002948888.1 DEAD/DEAH box helicase -
  H1W92_RS07960 (STHERMO_1749) mraY 1519202..1520224 (-) 1023 WP_011227524.1 phospho-N-acetylmuramoyl-pentapeptide- transferase -
  H1W92_RS07965 (STHERMO_1750) pbp2X 1520226..1522493 (-) 2268 WP_011226508.1 penicillin-binding protein PBP2X -
  H1W92_RS07970 (STHERMO_1751) ftsL 1522497..1522817 (-) 321 WP_011226509.1 cell division protein FtsL -
  H1W92_RS07975 (STHERMO_1752) rsmH 1522820..1523770 (-) 951 WP_002888254.1 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH -
  H1W92_RS07980 (STHERMO_1753) - 1523937..1524287 (-) 351 WP_011227526.1 hypothetical protein -
  H1W92_RS07985 (STHERMO_1754) - 1524384..1524587 (-) 204 WP_232086119.1 hypothetical protein -
  H1W92_RS09965 (STHERMO_1756) - 1524719..1524931 (-) 213 WP_232086120.1 hypothetical protein -
  H1W92_RS07995 (STHERMO_1758) - 1525042..1525296 (-) 255 WP_011227529.1 Wzz/FepE/Etk N-terminal domain-containing protein -
  H1W92_RS08000 (STHERMO_1759) - 1525570..1525926 (-) 357 WP_011226513.1 DUF805 domain-containing protein -
  H1W92_RS08005 (STHERMO_1760) - 1526146..1526442 (-) 297 WP_231108735.1 hypothetical protein -
  H1W92_RS08010 (STHERMO_1761) - 1526796..1528046 (-) 1251 WP_011226515.1 glutamate-5-semialdehyde dehydrogenase -
  H1W92_RS08015 (STHERMO_1762) proB 1528048..1528851 (-) 804 WP_002948808.1 glutamate 5-kinase -
  H1W92_RS08020 (STHERMO_1763) - 1528972..1530561 (-) 1590 WP_180475752.1 ABC transporter permease -
  H1W92_RS08025 (STHERMO_1764) - 1530564..1531296 (-) 733 Protein_1522 ABC transporter ATP-binding protein -
  H1W92_RS08030 (STHERMO_1767) - 1531570..1532303 (+) 734 Protein_1523 DUF554 domain-containing protein -
  H1W92_RS08035 (STHERMO_1768) addA 1532697..1536350 (-) 3654 WP_011227531.1 helicase-exonuclease AddAB subunit AddA -

Sequence


Protein


Download         Length: 358 a.a.        Molecular weight: 39232.11 Da        Isoelectric Point: 9.4944

>NTDB_id=1131958 H1W92_RS07760 WP_011226464.1 1475317..1476393(-) (sepM) [Streptococcus thermophilus isolate STH_CIRM_1116]
MANKTKSKSLLEKMWRIKWWLLSIFTVLFLLFALFFPLNNYYVELPGGAFDTKEVLTVNKKADDSKGSYNFVAVAQTKAT
LALMLYTQFNDFAKLQTAEEATGNYSDEDFMRINQFYMETSQNQAVYQGLTLAGKEVSLEYMGVYVLQVADDSSFKGVLN
IADTVTAVNGKTFDNSTDMIKYVQGLKLGSKVKVTYMRDGKEKTATGKIIKIANGKNGIGIGLTDHTEIKSPENVKFKLD
GVGGPSAGLMFTLAIYDQVSGQDLKAGRKIAGTGTIEKDGAVGDIGGAYLKVKSAADSGADIFFVPNNLVTKEMKKADPD
AKTNYQEAKEAAEKLGTKMKIVPVKTAQEAIDYLKKTK

Nucleotide


Download         Length: 1077 bp        

>NTDB_id=1131958 H1W92_RS07760 WP_011226464.1 1475317..1476393(-) (sepM) [Streptococcus thermophilus isolate STH_CIRM_1116]
GTGGCAAACAAGACAAAATCTAAATCGCTATTAGAGAAAATGTGGCGTATTAAGTGGTGGTTATTAAGTATTTTTACGGT
ACTTTTCCTCCTTTTTGCCCTCTTTTTCCCGCTCAATAATTACTATGTGGAGCTTCCGGGTGGTGCTTTTGATACCAAGG
AAGTCTTGACAGTGAATAAGAAAGCTGATGATTCTAAGGGCTCCTATAATTTTGTGGCGGTGGCTCAAACCAAGGCGACT
TTGGCCTTGATGCTCTATACTCAGTTTAATGATTTTGCAAAGCTTCAAACGGCTGAAGAGGCAACTGGAAATTACTCTGA
TGAAGATTTCATGCGCATCAACCAATTTTACATGGAGACTTCTCAAAACCAAGCGGTTTATCAGGGCTTGACTCTGGCTG
GTAAGGAGGTTAGTTTGGAGTATATGGGTGTCTATGTGCTTCAGGTTGCTGATGATTCTAGCTTCAAGGGTGTCCTCAAT
ATTGCTGATACGGTGACGGCTGTTAATGGTAAGACCTTTGATAATTCTACTGACATGATTAAATACGTTCAAGGACTTAA
GCTGGGTTCAAAGGTCAAGGTCACTTATATGAGAGATGGCAAAGAAAAGACTGCTACTGGTAAGATTATTAAGATTGCCA
ATGGCAAAAATGGTATTGGTATCGGCCTAACGGACCATACTGAGATCAAGAGTCCTGAGAATGTTAAGTTTAAACTGGAT
GGTGTCGGTGGGCCAAGTGCTGGTCTTATGTTTACCTTGGCTATTTACGATCAGGTGTCTGGTCAAGACCTCAAGGCTGG
CCGCAAGATTGCTGGTACAGGAACTATTGAAAAAGATGGGGCTGTCGGTGATATCGGTGGGGCCTATCTCAAGGTGAAAT
CTGCGGCTGATAGTGGCGCAGACATTTTCTTCGTGCCAAATAATCTAGTAACTAAGGAAATGAAAAAGGCTGATCCGGAT
GCCAAGACTAATTATCAAGAGGCCAAGGAAGCTGCCGAGAAACTGGGGACCAAGATGAAAATCGTCCCTGTTAAAACAGC
TCAAGAAGCCATTGATTATTTGAAAAAGACTAAATGA

Domains


Predicted by InterproScan.

(137-206)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sepM Streptococcus mutans UA159

62.757

95.251

0.598


Multiple sequence alignment