Detailed information    

insolico Bioinformatically predicted

Overview


Name   sepM   Type   Regulator
Locus tag   H1W91_RS07895 Genome accession   NZ_LR822032
Coordinates   1511983..1513059 (-) Length   358 a.a.
NCBI ID   WP_180477137.1    Uniprot ID   -
Organism   Streptococcus thermophilus isolate STH_CIRM_1050     
Function   processing of CSP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1497240..1570869 1511983..1513059 within 0


Gene organization within MGE regions


Location: 1497240..1570869
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H1W91_RS07825 (STHERMO_1710) - 1498130..1498681 (-) 552 WP_173940634.1 cysteine hydrolase family protein -
  H1W91_RS07830 (STHERMO_1711) codY 1498744..1499529 (-) 786 WP_002951720.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  H1W91_RS07835 (STHERMO_1712) - 1499789..1501003 (-) 1215 WP_180477135.1 pyridoxal phosphate-dependent aminotransferase -
  H1W91_RS07840 (STHERMO_1713) - 1501358..1501810 (+) 453 WP_180477136.1 universal stress protein -
  H1W91_RS10140 - 1501990..1502561 (+) 572 Protein_1492 IS30 family transposase -
  H1W91_RS07845 (STHERMO_1716) - 1502633..1502806 (-) 174 WP_011681546.1 hypothetical protein -
  H1W91_RS07850 (STHERMO_1717) - 1502867..1503241 (-) 375 WP_011681547.1 membrane protein -
  H1W91_RS07855 (STHERMO_1718) pflA 1503453..1504253 (-) 801 WP_002946980.1 pyruvate formate-lyase-activating protein -
  H1W91_RS07860 - 1504441..1504551 (-) 111 WP_014621906.1 LPXTG cell wall anchor domain-containing protein -
  H1W91_RS07865 (STHERMO_1720) - 1505249..1506580 (-) 1332 WP_002951727.1 hemolysin family protein -
  H1W91_RS07870 (STHERMO_1721) - 1506694..1507476 (+) 783 WP_011226459.1 ABC transporter ATP-binding protein -
  H1W91_RS10545 (STHERMO_1722) - 1507811..1508045 (+) 235 Protein_1499 hypothetical protein -
  H1W91_RS07875 (STHERMO_1723) - 1508095..1510161 (-) 2067 WP_011226460.1 cation:proton antiporter -
  H1W91_RS07880 (STHERMO_1724) - 1510170..1510412 (-) 243 WP_011226461.1 hypothetical protein -
  H1W91_RS07885 (STHERMO_1725) - 1510409..1510957 (-) 549 WP_011226462.1 tRNA (mnm(5)s(2)U34)-methyltransferase -
  H1W91_RS07890 (STHERMO_1726) - 1510954..1511898 (-) 945 WP_011226463.1 TIGR01212 family radical SAM protein -
  H1W91_RS07895 (STHERMO_1727) sepM 1511983..1513059 (-) 1077 WP_180477137.1 SepM family pheromone-processing serine protease Regulator
  H1W91_RS07900 (STHERMO_1728) coaD 1513037..1513534 (-) 498 WP_164178277.1 pantetheine-phosphate adenylyltransferase -
  H1W91_RS07905 (STHERMO_1729) rsmD 1513568..1514167 (-) 600 Protein_1506 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  H1W91_RS07910 (STHERMO_1730) trxB 1514258..1515211 (-) 954 WP_255136104.1 thioredoxin-disulfide reductase -
  H1W91_RS07915 (STHERMO_1731) - 1515244..1515468 (-) 225 WP_002951743.1 DUF4059 family protein -
  H1W91_RS07920 (STHERMO_1732) - 1515683..1516426 (-) 744 WP_164178279.1 amino acid ABC transporter ATP-binding protein -
  H1W91_RS07925 (STHERMO_1733) - 1516426..1517172 (-) 747 WP_095559509.1 amino acid ABC transporter permease -
  H1W91_RS07930 (STHERMO_1734) - 1517566..1518396 (-) 831 WP_180477138.1 transporter substrate-binding domain-containing protein -
  H1W91_RS07935 (STHERMO_1735) - 1518967..1519200 (-) 234 WP_002947030.1 hypothetical protein -
  H1W91_RS07940 (STHERMO_1736) dinB 1519498..1520601 (-) 1104 WP_014608654.1 DNA polymerase IV -
  H1W91_RS07945 (STHERMO_1737) pflB 1520880..1523189 (+) 2310 WP_180477139.1 formate C-acetyltransferase -
  H1W91_RS07950 - 1523456..1524238 (+) 783 Protein_1515 carbonic anhydrase -
  H1W91_RS07955 (STHERMO_1740) - 1524289..1524741 (+) 453 WP_176243562.1 GNAT family N-acetyltransferase -
  H1W91_RS07960 (STHERMO_1741) - 1525075..1525377 (-) 303 WP_232087099.1 restriction endonuclease subunit S -
  H1W91_RS10440 mobV 1525423..1525930 (-) 508 Protein_1518 MobV family relaxase -
  H1W91_RS07975 - 1526416..1527004 (-) 589 Protein_1519 site-specific integrase -
  H1W91_RS07980 (STHERMO_1745) - 1527092..1527775 (-) 684 WP_232087100.1 YdcF family protein -
  H1W91_RS07985 (STHERMO_1746) - 1527855..1528610 (-) 756 WP_180477142.1 ABC transporter permease -
  H1W91_RS07990 (STHERMO_1747) - 1528607..1529257 (-) 651 WP_180477143.1 ATP-binding cassette domain-containing protein -
  H1W91_RS07995 (STHERMO_1749) - 1529460..1530416 (-) 957 WP_180477144.1 serine hydrolase domain-containing protein -
  H1W91_RS08000 (STHERMO_1750) - 1530416..1531171 (-) 756 WP_180477145.1 CppA family protein -
  H1W91_RS08005 - 1531453..1531728 (+) 276 WP_232087101.1 CPBP family intramembrane glutamic endopeptidase -
  H1W91_RS08010 (STHERMO_1752) gla 1531902..1532765 (-) 864 WP_173940640.1 aquaglyceroporin Gla -
  H1W91_RS08015 (STHERMO_1753) - 1532886..1535153 (+) 2268 WP_180477146.1 Xaa-Pro dipeptidyl-peptidase -
  H1W91_RS08020 (STHERMO_1754) - 1535233..1535613 (-) 381 WP_002951783.1 hypothetical protein -
  H1W91_RS08025 - 1535738..1536001 (-) 264 WP_002945924.1 hypothetical protein -
  H1W91_RS08030 (STHERMO_1757) - 1536323..1536619 (-) 297 WP_004197070.1 bacteriocin immunity protein -
  H1W91_RS08035 (STHERMO_1758) - 1536784..1536966 (-) 183 WP_179973975.1 hypothetical protein -
  H1W91_RS08040 (STHERMO_1759) - 1537021..1537713 (-) 693 WP_224103184.1 thioredoxin family protein -
  H1W91_RS08045 - 1537904..1539474 (+) 1571 WP_087009847.1 IS3-like element ISSth1b family transposase -
  H1W91_RS08050 (STHERMO_1762) - 1539620..1539886 (-) 267 WP_180477147.1 Blp family class II bacteriocin -
  H1W91_RS10445 (STHERMO_1763) - 1540137..1540538 (-) 402 WP_311316656.1 hypothetical protein -
  H1W91_RS08055 (STHERMO_1767) - 1541525..1541755 (-) 231 WP_011226494.1 bacteriocin class II family protein -
  H1W91_RS08060 (STHERMO_1768) - 1542005..1542736 (+) 732 WP_180477148.1 LytR/AlgR family response regulator transcription factor -
  H1W91_RS10150 - 1543273..1544076 (+) 804 WP_224103634.1 ATP-binding protein -
  H1W91_RS08070 (STHERMO_1770) - 1544094..1544255 (-) 162 WP_011226496.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  H1W91_RS08075 (STHERMO_1771) - 1544270..1545637 (-) 1368 WP_180477149.1 bacteriocin secretion accessory protein -
  H1W91_RS08080 - 1545653..1547806 (-) 2154 Protein_1541 peptide cleavage/export ABC transporter -
  H1W91_RS08085 (STHERMO_1777) - 1548820..1550565 (-) 1746 WP_180477150.1 ABC transporter ATP-binding protein -
  H1W91_RS08090 (STHERMO_1778) - 1550558..1552315 (-) 1758 WP_180477151.1 ABC transporter ATP-binding protein -
  H1W91_RS10155 (STHERMO_1780) - 1552503..1552709 (-) 207 WP_232087102.1 hypothetical protein -
  H1W91_RS08100 (STHERMO_1782) - 1552914..1553441 (-) 528 WP_180477152.1 VanZ family protein -
  H1W91_RS08105 (STHERMO_1783) rlmN 1553443..1554612 (-) 1170 WP_011226504.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  H1W91_RS08110 (STHERMO_1784) - 1554616..1555338 (-) 723 WP_014621927.1 YutD family protein -
  H1W91_RS08115 (STHERMO_1785) - 1555393..1556748 (-) 1356 WP_002948886.1 bifunctional metallophosphatase/5'-nucleotidase -
  H1W91_RS08120 (STHERMO_1788) - 1557596..1558939 (-) 1344 WP_002948888.1 DEAD/DEAH box helicase -
  H1W91_RS08125 (STHERMO_1789) mraY 1559014..1560036 (-) 1023 WP_011227524.1 phospho-N-acetylmuramoyl-pentapeptide- transferase -
  H1W91_RS08130 (STHERMO_1790) pbp2X 1560038..1562305 (-) 2268 WP_180477153.1 penicillin-binding protein PBP2X -
  H1W91_RS08135 (STHERMO_1791) ftsL 1562309..1562629 (-) 321 WP_014608671.1 cell division protein FtsL -
  H1W91_RS08140 (STHERMO_1792) rsmH 1562632..1563582 (-) 951 WP_002888254.1 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH -
  H1W91_RS08145 (STHERMO_1793) - 1563748..1564281 (-) 534 WP_232087103.1 hypothetical protein -
  H1W91_RS08150 (STHERMO_1794) - 1564288..1564740 (-) 453 WP_232087104.1 hypothetical protein -
  H1W91_RS08155 (STHERMO_1796) - 1564823..1565071 (+) 249 WP_002951833.1 hypothetical protein -
  H1W91_RS08160 (STHERMO_1798) - 1565377..1565733 (-) 357 Protein_1557 DUF805 domain-containing protein -
  H1W91_RS08165 (STHERMO_1800) - 1565952..1566242 (-) 291 WP_232087105.1 hypothetical protein -
  H1W91_RS08170 (STHERMO_1801) - 1566576..1567826 (-) 1251 WP_065972556.1 glutamate-5-semialdehyde dehydrogenase -
  H1W91_RS08175 (STHERMO_1802) proB 1567828..1568631 (-) 804 WP_002948808.1 glutamate 5-kinase -
  H1W91_RS08180 (STHERMO_1803) - 1568752..1570341 (-) 1590 WP_180477154.1 DUF4231 domain-containing protein -

Sequence


Protein


Download         Length: 358 a.a.        Molecular weight: 39216.11 Da        Isoelectric Point: 9.4944

>NTDB_id=1131601 H1W91_RS07895 WP_180477137.1 1511983..1513059(-) (sepM) [Streptococcus thermophilus isolate STH_CIRM_1050]
MANKTKSKSLLEKMWRIKWWLLSIFTVLFLLFALFFPLNNYYVELPGGAFDTKEVLTVNKKADDSKGSYNFVAVAQTKAT
LALMLYAQFNDFAKLQTAEEATGNYSDEDFMRINQFYMETSQNQAVYQGLTLAGKEVSLEYMGVYVLQVADDSSFKGILN
IADTVTAVNGKTFDNSTDMIKYVQGLKLGSKVKVTYMRDGKEKTATGKIIKIANGKNGIGIGLTDHTEIKSPENVKFKLD
GVGGPSAGLMFTLAIYDQVSGQDLKAGRKIAGTGTIEKDGAVGDIGGAYLKVKSAADSGADIFFVPNNLVTKEMKKADPD
AKTNYQEAKEAAEKLGTKMKIVPVKTAQEAIDYLKKTK

Nucleotide


Download         Length: 1077 bp        

>NTDB_id=1131601 H1W91_RS07895 WP_180477137.1 1511983..1513059(-) (sepM) [Streptococcus thermophilus isolate STH_CIRM_1050]
GTGGCAAACAAGACAAAATCTAAATCGCTATTAGAGAAAATGTGGCGTATTAAGTGGTGGTTATTAAGTATTTTTACGGT
ACTTTTCCTCCTTTTTGCCCTCTTTTTCCCGCTCAATAATTACTATGTGGAGCTTCCGGGTGGTGCTTTTGATACCAAGG
AAGTCTTGACAGTGAATAAGAAAGCTGATGATTCTAAGGGCTCCTATAATTTTGTGGCGGTGGCTCAAACCAAGGCGACT
TTGGCCTTGATGCTCTATGCTCAGTTTAATGATTTTGCAAAGCTTCAAACGGCTGAAGAGGCAACTGGAAATTACTCTGA
TGAAGATTTCATGCGCATCAACCAATTTTACATGGAGACTTCTCAAAACCAAGCGGTTTATCAGGGCTTGACTCTGGCTG
GTAAGGAGGTTAGTTTGGAGTATATGGGTGTCTATGTGCTTCAGGTTGCTGATGATTCTAGCTTCAAGGGTATCCTCAAT
ATTGCTGATACGGTGACGGCTGTTAATGGTAAGACCTTTGATAATTCTACTGACATGATTAAATACGTTCAAGGACTTAA
GCTGGGTTCAAAGGTCAAGGTCACTTATATGAGAGATGGCAAAGAAAAGACTGCTACTGGTAAGATTATTAAGATTGCCA
ATGGCAAAAATGGTATTGGTATCGGCCTAACGGACCATACTGAGATCAAGAGTCCTGAGAATGTTAAGTTTAAACTGGAT
GGTGTCGGTGGGCCAAGTGCTGGTCTTATGTTTACCTTGGCTATTTACGATCAGGTGTCTGGTCAAGACCTCAAGGCTGG
CCGCAAGATTGCTGGTACAGGAACTATTGAAAAAGATGGGGCTGTCGGTGATATCGGTGGGGCCTATCTCAAGGTGAAAT
CTGCGGCTGATAGTGGCGCAGACATTTTCTTCGTGCCAAATAATCTAGTAACTAAGGAAATGAAAAAGGCTGATCCGGAT
GCCAAGACTAATTATCAAGAGGCCAAGGAAGCTGCCGAGAAACTGGGGACCAAGATGAAAATCGTCCCTGTTAAAACAGC
TCAAGAAGCCATTGATTATTTGAAAAAGACTAAATGA

Domains


Predicted by InterproScan.

(137-206)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sepM Streptococcus mutans UA159

62.757

95.251

0.598


Multiple sequence alignment