Detailed information    

insolico Bioinformatically predicted

Overview


Name   amiE   Type   Regulator
Locus tag   H1W91_RS06930 Genome accession   NZ_LR822032
Coordinates   1328113..1329198 (-) Length   361 a.a.
NCBI ID   WP_011226304.1    Uniprot ID   -
Organism   Streptococcus thermophilus isolate STH_CIRM_1050     
Function   internalize XIP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1310237..1382252 1328113..1329198 within 0


Gene organization within MGE regions


Location: 1310237..1382252
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H1W91_RS06845 (STHERMO_1499) liaF 1310245..1310943 (-) 699 WP_180477088.1 cell wall-active antibiotics response protein LiaF -
  H1W91_RS10120 (STHERMO_1500) - 1311209..1311364 (-) 156 WP_232087096.1 ion channel -
  H1W91_RS06855 (STHERMO_1503) - 1312097..1313346 (+) 1250 Protein_1295 ISL3 family transposase -
  H1W91_RS06860 (STHERMO_1504) stkP/pknB 1313420..1315291 (-) 1872 WP_011226292.1 Stk1 family PASTA domain-containing Ser/Thr kinase Regulator
  H1W91_RS06865 (STHERMO_1505) - 1315291..1316028 (-) 738 WP_002946881.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  H1W91_RS06870 (STHERMO_1506) rsmB 1316072..1317394 (-) 1323 WP_014608533.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  H1W91_RS06875 (STHERMO_1507) fmt 1317384..1318319 (-) 936 WP_002951411.1 methionyl-tRNA formyltransferase -
  H1W91_RS06880 (STHERMO_1508) - 1318337..1320733 (-) 2397 WP_176243306.1 primosomal protein N' -
  H1W91_RS06885 (STHERMO_1509) rpoZ 1320875..1321189 (-) 315 WP_002951415.1 DNA-directed RNA polymerase subunit omega -
  H1W91_RS06890 (STHERMO_1510) gmk 1321211..1321840 (-) 630 WP_022096878.1 guanylate kinase -
  H1W91_RS06895 (STHERMO_1511) ftsY 1322073..1323464 (-) 1392 WP_180477090.1 signal recognition particle-docking protein FtsY -
  H1W91_RS06900 (STHERMO_1512) - 1323475..1324293 (-) 819 WP_011681411.1 Cof-type HAD-IIB family hydrolase -
  H1W91_RS06905 (STHERMO_1513) - 1324286..1325080 (-) 795 WP_180477091.1 HAD hydrolase family protein -
  H1W91_RS06910 (STHERMO_1514) - 1325264..1325641 (+) 378 WP_011226300.1 GntR family transcriptional regulator -
  H1W91_RS06915 (STHERMO_1515) - 1325646..1326344 (+) 699 WP_022096876.1 ABC transporter ATP-binding protein -
  H1W91_RS06920 (STHERMO_1516) - 1326356..1327141 (+) 786 WP_180477092.1 ABC transporter permease -
  H1W91_RS06925 (STHERMO_1517) amiF 1327191..1328120 (-) 930 WP_002951426.1 ATP-binding cassette domain-containing protein Regulator
  H1W91_RS06930 (STHERMO_1518) amiE 1328113..1329198 (-) 1086 WP_011226304.1 ABC transporter ATP-binding protein Regulator
  H1W91_RS06935 (STHERMO_1519) amiD 1329208..1330134 (-) 927 WP_002946409.1 oligopeptide ABC transporter permease OppC Regulator
  H1W91_RS06940 (STHERMO_1520) amiC 1330134..1331627 (-) 1494 WP_011227407.1 ABC transporter permease Regulator
  H1W91_RS06945 (STHERMO_1521) amiA 1331689..1333656 (-) 1968 WP_180477093.1 peptide ABC transporter substrate-binding protein Regulator
  H1W91_RS09700 (STHERMO_1522) - 1334012..1335261 (+) 1250 Protein_1314 ISL3 family transposase -
  H1W91_RS06955 (STHERMO_1523) amiA3 1335316..1337289 (-) 1974 WP_180477094.1 peptide ABC transporter substrate-binding protein Regulator
  H1W91_RS06960 - 1337493..1337683 (-) 191 Protein_1316 IS3 family transposase -
  H1W91_RS10535 - 1337677..1338087 (-) 411 Protein_1317 ATP-binding cassette domain-containing protein -
  H1W91_RS10540 (STHERMO_1526) - 1338119..1338432 (-) 314 Protein_1318 TatD family hydrolase -
  H1W91_RS06980 (STHERMO_1527) - 1338778..1339983 (+) 1206 WP_011227415.1 OFA family MFS transporter -
  H1W91_RS06985 - 1340030..1341384 (-) 1355 Protein_1320 IS3 family transposase -
  H1W91_RS06990 (STHERMO_1532) pta 1341470..1342453 (-) 984 WP_011227420.1 phosphate acetyltransferase -
  H1W91_RS06995 (STHERMO_1533) - 1342463..1343362 (-) 900 WP_180477095.1 RluA family pseudouridine synthase -
  H1W91_RS07000 (STHERMO_1534) - 1343359..1344195 (-) 837 WP_065972449.1 NAD kinase -
  H1W91_RS07005 (STHERMO_1535) - 1344167..1344841 (-) 675 WP_011681427.1 GTP pyrophosphokinase family protein -
  H1W91_RS07010 (STHERMO_1536) - 1344937..1345512 (+) 576 WP_002951444.1 CYTH domain-containing protein -
  H1W91_RS07015 (STHERMO_1537) - 1345877..1346848 (+) 972 WP_002951446.1 ribose-phosphate diphosphokinase -
  H1W91_RS07020 (STHERMO_1538) - 1346852..1347964 (+) 1113 WP_082309052.1 cysteine desulfurase family protein -
  H1W91_RS07025 (STHERMO_1539) - 1347966..1348313 (+) 348 WP_180477096.1 DUF1831 domain-containing protein -
  H1W91_RS07030 (STHERMO_1540) - 1348457..1349116 (+) 660 WP_041828288.1 redox-sensing transcriptional repressor Rex -
  H1W91_RS07035 - 1349109..1349804 (+) 696 Protein_1330 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein -
  H1W91_RS07040 (STHERMO_1543) radC 1349857..1350543 (-) 687 WP_011226324.1 RadC family protein -
  H1W91_RS07045 (STHERMO_1544) - 1350722..1352062 (-) 1341 WP_231108743.1 DUF2142 domain-containing protein -
  H1W91_RS07050 (STHERMO_1545) - 1352211..1353956 (-) 1746 WP_011227426.1 rhamnan synthesis F family protein -
  H1W91_RS07055 (STHERMO_1546) - 1353958..1355700 (-) 1743 WP_180477097.1 glycosyltransferase family 4 protein -
  H1W91_RS07060 (STHERMO_1547) - 1355718..1356920 (-) 1203 WP_180477098.1 ABC transporter ATP-binding protein -
  H1W91_RS07065 (STHERMO_1548) - 1356920..1357726 (-) 807 WP_011227429.1 ABC transporter permease -
  H1W91_RS07070 (STHERMO_1549) - 1357726..1358667 (-) 942 WP_011227430.1 glycosyltransferase family 2 protein -
  H1W91_RS07075 (STHERMO_1550) cps2T 1358664..1359812 (-) 1149 WP_011227431.1 beta 1-4 rhamnosyltransferase Cps2T -
  H1W91_RS07080 (STHERMO_1551) - 1359931..1360713 (-) 783 WP_011227432.1 glycosyltransferase family A protein -
  H1W91_RS07085 (STHERMO_1552) - 1360714..1361046 (-) 333 WP_011227433.1 DUF2304 domain-containing protein -
  H1W91_RS07090 (STHERMO_1553) - 1361052..1361747 (-) 696 WP_173405413.1 glycosyltransferase family 2 protein -
  H1W91_RS07095 - 1361831..1362303 (-) 473 Protein_1342 glycosyltransferase family 2 protein -
  H1W91_RS07100 (STHERMO_1556) - 1362368..1363354 (-) 987 WP_180477099.1 glycosyltransferase family 2 protein -
  H1W91_RS07105 (STHERMO_1557) - 1363351..1364610 (-) 1260 WP_180477100.1 oligosaccharide flippase family protein -
  H1W91_RS07110 (STHERMO_1558) rfbD 1364731..1365582 (-) 852 WP_014621820.1 dTDP-4-dehydrorhamnose reductase -
  H1W91_RS07115 (STHERMO_1559) - 1365700..1366626 (-) 927 WP_011227439.1 glycosyltransferase family 2 protein -
  H1W91_RS07120 (STHERMO_1560) - 1366636..1366971 (-) 336 WP_002891474.1 metal-sulfur cluster assembly factor -
  H1W91_RS07125 (STHERMO_1561) rpoD 1367025..1368134 (-) 1110 WP_179970613.1 RNA polymerase sigma factor RpoD -
  H1W91_RS07130 (STHERMO_1562) dnaG 1368138..1369949 (-) 1812 WP_180477101.1 DNA primase -
  H1W91_RS07135 (STHERMO_1563) mscL 1370089..1370172 (+) 84 Protein_1350 large conductance mechanosensitive channel protein MscL -
  H1W91_RS07140 (STHERMO_1564) rpsU 1370332..1370508 (-) 177 WP_082309068.1 30S ribosomal protein S21 -
  H1W91_RS07145 (STHERMO_1565) - 1370703..1371497 (-) 795 WP_180477102.1 ABC transporter substrate-binding protein -
  H1W91_RS07150 (STHERMO_1566) - 1371590..1372699 (-) 1110 WP_180477103.1 aminotransferase -
  H1W91_RS07155 (STHERMO_1567) - 1373046..1373843 (-) 798 WP_141326473.1 transporter substrate-binding domain-containing protein -
  H1W91_RS07160 (STHERMO_1568) - 1373840..1374670 (-) 831 WP_087010081.1 transporter substrate-binding domain-containing protein -
  H1W91_RS07165 (STHERMO_1569) - 1374883..1375346 (-) 464 Protein_1356 8-oxo-dGTP diphosphatase -
  H1W91_RS07170 (STHERMO_1570) uvrB 1375391..1377382 (-) 1992 WP_002953358.1 excinuclease ABC subunit UvrB -
  H1W91_RS07175 (STHERMO_1571) - 1377529..1377996 (-) 468 WP_084829769.1 hypothetical protein -
  H1W91_RS07180 - 1378069..1379005 (-) 937 Protein_1359 CPBP family intramembrane glutamic endopeptidase -
  H1W91_RS07185 (STHERMO_1573) - 1379204..1381414 (+) 2211 WP_011226350.1 ABC transporter substrate-binding protein/permease -
  H1W91_RS07190 (STHERMO_1574) - 1381414..1382154 (+) 741 WP_002945131.1 amino acid ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 361 a.a.        Molecular weight: 39864.62 Da        Isoelectric Point: 4.7435

>NTDB_id=1131592 H1W91_RS06930 WP_011226304.1 1328113..1329198(-) (amiE) [Streptococcus thermophilus isolate STH_CIRM_1050]
MTENKNVILSARDIVVEFDVRDRVLTAIRGVSLDLVEGEVLALVGESGSGKSVLTKTFTGMLEENGRVASGSIDYRGKDL
TKFKSHQDWAAIRGAKIATIFQDPMTSLNPIKTIGSQIIEVIVKHQGKTAKEAKKMAIDYMDKVGIPDAEKRFNEYPFQY
SGGMRQRIVIAIALACRPDVLICDEPTTALDVTIQAQIIDLLKSLKEEYGFSVIFITHDLGVVASIADKVAVMYAGEIIE
YATVEEIFYEPCHPYTWSLLSSLPQLADDNGKLFSIPGTPPSLYTPVVGDAFALRSDYALQIDFEEKAPQFQVSDTHWAK
TWLLHEDAPKVDKPAVIQNLHEKILANMGFAHLGDEEEGNA

Nucleotide


Download         Length: 1086 bp        

>NTDB_id=1131592 H1W91_RS06930 WP_011226304.1 1328113..1329198(-) (amiE) [Streptococcus thermophilus isolate STH_CIRM_1050]
ATGACAGAAAATAAAAATGTAATATTATCGGCTCGCGATATCGTCGTGGAATTTGACGTTCGTGACCGTGTTTTGACAGC
TATTCGAGGGGTTTCCCTTGATTTAGTTGAAGGTGAAGTTTTAGCCTTGGTTGGTGAATCTGGTTCAGGAAAATCAGTCT
TGACTAAAACTTTTACAGGGATGCTGGAAGAAAATGGTCGTGTAGCTAGCGGATCTATCGACTACCGTGGCAAAGACTTG
ACTAAATTTAAGAGTCACCAAGATTGGGCAGCTATCCGTGGAGCTAAGATTGCAACTATTTTCCAAGATCCAATGACCAG
TCTTAACCCAATTAAGACTATCGGAAGTCAAATTATTGAAGTTATTGTTAAGCACCAAGGGAAAACAGCCAAGGAAGCTA
AAAAAATGGCAATTGATTACATGGACAAGGTTGGTATTCCAGATGCTGAAAAACGTTTCAATGAATATCCTTTCCAATAC
TCTGGTGGGATGCGTCAACGTATCGTTATTGCCATTGCCTTGGCTTGTCGTCCTGATGTCCTTATCTGTGACGAACCAAC
AACTGCCCTTGATGTGACCATTCAAGCTCAAATCATTGACCTCTTGAAATCACTCAAAGAGGAGTATGGTTTCTCGGTCA
TTTTCATTACCCATGACCTTGGCGTCGTAGCAAGTATCGCGGACAAGGTTGCTGTCATGTATGCTGGCGAAATCATTGAA
TACGCAACTGTTGAGGAAATTTTCTATGAGCCTTGTCATCCATACACGTGGAGCTTGCTTTCAAGTCTGCCACAATTGGC
TGATGATAATGGAAAACTCTTCTCAATTCCAGGGACGCCACCATCACTTTATACACCAGTTGTTGGGGATGCCTTTGCCT
TGCGTTCAGATTATGCTTTGCAGATTGATTTTGAGGAAAAAGCACCACAATTCCAAGTTTCAGATACTCACTGGGCTAAG
ACCTGGCTCTTACATGAGGATGCGCCAAAAGTTGATAAACCTGCGGTTATCCAAAATCTACATGAAAAAATCCTAGCCAA
TATGGGATTTGCACATTTAGGAGATGAGGAGGAAGGCAATGCCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  amiE Streptococcus thermophilus LMG 18311

100

100

1

  amiE Streptococcus thermophilus LMD-9

100

100

1

  amiE Streptococcus salivarius strain HSISS4

96.953

100

0.97

  oppD Streptococcus mutans UA159

54.441

96.676

0.526


Multiple sequence alignment