Detailed information
Bioinformatically predicted
Overview
| Name | amiD | Type | Regulator |
| Locus tag | H1W89_RS02910 | Genome accession | NZ_LR822029 |
| Coordinates | 544482..545408 (+) | Length | 308 a.a. |
| NCBI ID | WP_002946409.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus isolate STH_CIRM_1035 | ||
| Function | internalize XIP (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 491618..562953 | 544482..545408 | within | 0 |
Gene organization within MGE regions
Location: 491618..562953
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1W89_RS02650 (STHERMO_0551) | - | 491717..492457 (-) | 741 | WP_011681459.1 | amino acid ABC transporter ATP-binding protein | - |
| H1W89_RS02655 (STHERMO_0552) | - | 492457..494667 (-) | 2211 | WP_180474512.1 | ABC transporter substrate-binding protein/permease | - |
| H1W89_RS02660 | - | 494866..495802 (+) | 937 | Protein_474 | CPBP family intramembrane glutamic endopeptidase | - |
| H1W89_RS02665 (STHERMO_0555) | - | 495875..496342 (+) | 468 | WP_014608580.1 | hypothetical protein | - |
| H1W89_RS02670 (STHERMO_0556) | uvrB | 496489..498480 (+) | 1992 | WP_014608579.1 | excinuclease ABC subunit UvrB | - |
| H1W89_RS02675 (STHERMO_0557) | - | 498525..498989 (+) | 465 | WP_011681454.1 | 8-oxo-dGTP diphosphatase | - |
| H1W89_RS02680 (STHERMO_0558) | - | 499203..500033 (+) | 831 | WP_014621829.1 | transporter substrate-binding domain-containing protein | - |
| H1W89_RS02685 (STHERMO_0559) | - | 500030..500827 (+) | 798 | WP_014621828.1 | transporter substrate-binding domain-containing protein | - |
| H1W89_RS02690 (STHERMO_0560) | - | 501174..502283 (+) | 1110 | WP_014608576.1 | aminotransferase | - |
| H1W89_RS02695 (STHERMO_0561) | - | 502345..503139 (+) | 795 | WP_011681450.1 | transporter substrate-binding domain-containing protein | - |
| H1W89_RS02700 (STHERMO_0562) | rpsU | 503334..503510 (+) | 177 | WP_011681449.1 | 30S ribosomal protein S21 | - |
| H1W89_RS02705 | mscL | 503670..503750 (-) | 81 | Protein_483 | large conductance mechanosensitive channel protein MscL | - |
| H1W89_RS02710 (STHERMO_0563) | dnaG | 503893..505704 (+) | 1812 | WP_011681448.1 | DNA primase | - |
| H1W89_RS02715 (STHERMO_0564) | rpoD | 505708..506817 (+) | 1110 | WP_011227440.1 | RNA polymerase sigma factor RpoD | - |
| H1W89_RS02720 (STHERMO_0565) | - | 506871..507206 (+) | 336 | WP_002891474.1 | metal-sulfur cluster assembly factor | - |
| H1W89_RS02725 (STHERMO_0567) | - | 507540..508955 (+) | 1416 | WP_180474513.1 | DUF2142 domain-containing protein | - |
| H1W89_RS02730 (STHERMO_0568) | - | 509018..509935 (+) | 918 | WP_002946425.1 | glycosyltransferase family 2 protein | - |
| H1W89_RS02735 (STHERMO_0570) | - | 510048..511382 (+) | 1335 | WP_138496513.1 | DUF6056 family protein | - |
| H1W89_RS02740 (STHERMO_0571) | rfbD | 511459..512310 (+) | 852 | WP_014727637.1 | dTDP-4-dehydrorhamnose reductase | - |
| H1W89_RS02745 (STHERMO_0572) | - | 512387..513082 (+) | 696 | WP_171073564.1 | glycosyltransferase family 2 protein | - |
| H1W89_RS02750 (STHERMO_0573) | - | 513088..513420 (+) | 333 | WP_011226332.1 | DUF2304 domain-containing protein | - |
| H1W89_RS02755 (STHERMO_0574) | - | 513413..514690 (+) | 1278 | WP_014727635.1 | lipopolysaccharide biosynthesis protein | - |
| H1W89_RS02760 (STHERMO_0575) | - | 514687..515697 (+) | 1011 | WP_011226330.1 | glycosyltransferase family 2 protein | - |
| H1W89_RS02765 (STHERMO_0576) | cps2T | 515806..516954 (+) | 1149 | WP_002948014.1 | beta 1-4 rhamnosyltransferase Cps2T | - |
| H1W89_RS02770 (STHERMO_0577) | - | 516951..517907 (+) | 957 | WP_014727634.1 | glycosyltransferase family 2 protein | - |
| H1W89_RS02775 (STHERMO_0578) | - | 517891..518700 (+) | 810 | WP_002948020.1 | ABC transporter permease | - |
| H1W89_RS02780 (STHERMO_0579) | - | 518700..519905 (+) | 1206 | WP_014727633.1 | ABC transporter ATP-binding protein | - |
| H1W89_RS02785 (STHERMO_0580) | - | 519925..520980 (+) | 1056 | WP_002948022.1 | glycosyltransferase family 2 protein | - |
| H1W89_RS02790 (STHERMO_0581) | - | 520977..522761 (+) | 1785 | WP_014727631.1 | rhamnan synthesis F family protein | - |
| H1W89_RS02795 (STHERMO_0582) | radC | 522810..523496 (+) | 687 | WP_011226324.1 | RadC family protein | - |
| H1W89_RS02800 (STHERMO_0583) | - | 523549..524244 (-) | 696 | WP_180474514.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
| H1W89_RS02805 (STHERMO_0584) | - | 524237..524896 (-) | 660 | WP_024703944.1 | redox-sensing transcriptional repressor Rex | - |
| H1W89_RS02810 (STHERMO_0585) | - | 525040..525387 (-) | 348 | WP_014608555.1 | DUF1831 domain-containing protein | - |
| H1W89_RS02815 (STHERMO_0586) | - | 525389..526501 (-) | 1113 | WP_014608554.1 | cysteine desulfurase family protein | - |
| H1W89_RS02820 (STHERMO_0587) | - | 526505..527476 (-) | 972 | WP_002951446.1 | ribose-phosphate diphosphokinase | - |
| H1W89_RS02825 (STHERMO_0588) | - | 527839..528414 (-) | 576 | WP_002951444.1 | CYTH domain-containing protein | - |
| H1W89_RS02830 (STHERMO_0589) | - | 528510..529184 (+) | 675 | WP_011681427.1 | GTP pyrophosphokinase family protein | - |
| H1W89_RS02835 (STHERMO_0590) | - | 529156..529992 (+) | 837 | WP_014608552.1 | NAD kinase | - |
| H1W89_RS02840 (STHERMO_0591) | - | 529989..530885 (+) | 897 | WP_014727627.1 | RluA family pseudouridine synthase | - |
| H1W89_RS02845 (STHERMO_0592) | pta | 530899..531882 (+) | 984 | WP_011227420.1 | phosphate acetyltransferase | - |
| H1W89_RS02850 | - | 532007..533321 (+) | 1315 | Protein_512 | IS3 family transposase | - |
| H1W89_RS02855 (STHERMO_0598) | - | 533367..534572 (-) | 1206 | WP_011681420.1 | OFA family MFS transporter | - |
| H1W89_RS10380 (STHERMO_0599) | - | 534920..535234 (+) | 315 | Protein_514 | TatD family hydrolase | - |
| H1W89_RS10385 | - | 535266..535678 (+) | 413 | Protein_515 | ATP-binding cassette domain-containing protein | - |
| H1W89_RS02875 | - | 535669..535853 (+) | 185 | Protein_516 | IS3 family transposase | - |
| H1W89_RS02885 (STHERMO_0605) | amiA3 | 537343..539310 (+) | 1968 | WP_180474515.1 | peptide ABC transporter substrate-binding protein | Regulator |
| H1W89_RS02890 (STHERMO_0606) | - | 539355..540605 (-) | 1251 | Protein_519 | ISL3 family transposase | - |
| H1W89_RS02900 (STHERMO_0608) | amiA | 540960..542927 (+) | 1968 | WP_014621802.1 | peptide ABC transporter substrate-binding protein | Regulator |
| H1W89_RS02905 (STHERMO_0609) | amiC | 542989..544482 (+) | 1494 | WP_014608541.1 | ABC transporter permease | Regulator |
| H1W89_RS02910 (STHERMO_0610) | amiD | 544482..545408 (+) | 927 | WP_002946409.1 | oligopeptide ABC transporter permease OppC | Regulator |
| H1W89_RS02915 (STHERMO_0611) | amiE | 545418..546503 (+) | 1086 | WP_011226304.1 | ABC transporter ATP-binding protein | Regulator |
| H1W89_RS02920 (STHERMO_0612) | amiF | 546496..547425 (+) | 930 | WP_002951426.1 | ATP-binding cassette domain-containing protein | Regulator |
| H1W89_RS02925 (STHERMO_0613) | - | 547475..548259 (-) | 785 | Protein_525 | ABC transporter permease | - |
| H1W89_RS02930 (STHERMO_0615) | - | 548271..548969 (-) | 699 | WP_014608540.1 | ABC transporter ATP-binding protein | - |
| H1W89_RS02935 (STHERMO_0616) | - | 548974..549351 (-) | 378 | WP_011681413.1 | GntR family transcriptional regulator | - |
| H1W89_RS02940 (STHERMO_0618) | - | 549535..550329 (+) | 795 | WP_180474516.1 | HAD-IIB family hydrolase | - |
| H1W89_RS02945 (STHERMO_0619) | - | 550322..551137 (+) | 816 | WP_014608539.1 | Cof-type HAD-IIB family hydrolase | - |
| H1W89_RS02950 (STHERMO_0620) | ftsY | 551151..552542 (+) | 1392 | WP_014608538.1 | signal recognition particle-docking protein FtsY | - |
| H1W89_RS02955 (STHERMO_0621) | gmk | 552768..553397 (+) | 630 | WP_014608537.1 | guanylate kinase | - |
| H1W89_RS02960 (STHERMO_0622) | rpoZ | 553419..553733 (+) | 315 | WP_002951415.1 | DNA-directed RNA polymerase subunit omega | - |
| H1W89_RS02965 (STHERMO_0623) | - | 553875..556271 (+) | 2397 | WP_014608535.1 | primosomal protein N' | - |
| H1W89_RS02970 (STHERMO_0624) | fmt | 556289..557224 (+) | 936 | WP_014608534.1 | methionyl-tRNA formyltransferase | - |
| H1W89_RS02975 (STHERMO_0625) | rsmB | 557214..558536 (+) | 1323 | WP_014608533.1 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
| H1W89_RS02980 (STHERMO_0626) | - | 558580..559317 (+) | 738 | WP_002946881.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| H1W89_RS02985 (STHERMO_0627) | stkP/pknB | 559317..561188 (+) | 1872 | WP_084831154.1 | Stk1 family PASTA domain-containing Ser/Thr kinase | Regulator |
| H1W89_RS09735 (STHERMO_0630) | - | 561825..561992 (+) | 168 | WP_014608530.1 | potassium channel family protein | - |
| H1W89_RS02995 (STHERMO_0631) | liaF | 562247..562945 (+) | 699 | WP_011226289.1 | cell wall-active antibiotics response protein LiaF | - |
Sequence
Protein
Download Length: 308 a.a. Molecular weight: 34694.85 Da Isoelectric Point: 9.7054
>NTDB_id=1131399 H1W89_RS02910 WP_002946409.1 544482..545408(+) (amiD) [Streptococcus thermophilus isolate STH_CIRM_1035]
MASIDKSKFQFVKRDDFASETIDAPSYSYWKSVMRQFFKKKSTVVMLGILITIILMSFIYPMFSKFDFNDVSKVNDFSLR
YVHPNAQYWFGTDGNGKSLFDSVWFGARNSILIAVIATFLNVIIGLLVGAVWGISKTFDMIMMEIYNIISNIPSLLVVIV
LTYSLGAGFWNMIFAMTVTGWIGIAYTIRIQIMRYRDLEYNLASRNLGTPTAKIVIKNIMPQLVSVIVTMASQLLPGFIS
YEAFLSYFGLGLPVTTPSLGRLISDYAQNVTVNAYLFWIPLTTLILVSLALFIVGQNLADASDPRTHR
MASIDKSKFQFVKRDDFASETIDAPSYSYWKSVMRQFFKKKSTVVMLGILITIILMSFIYPMFSKFDFNDVSKVNDFSLR
YVHPNAQYWFGTDGNGKSLFDSVWFGARNSILIAVIATFLNVIIGLLVGAVWGISKTFDMIMMEIYNIISNIPSLLVVIV
LTYSLGAGFWNMIFAMTVTGWIGIAYTIRIQIMRYRDLEYNLASRNLGTPTAKIVIKNIMPQLVSVIVTMASQLLPGFIS
YEAFLSYFGLGLPVTTPSLGRLISDYAQNVTVNAYLFWIPLTTLILVSLALFIVGQNLADASDPRTHR
Nucleotide
Download Length: 927 bp
>NTDB_id=1131399 H1W89_RS02910 WP_002946409.1 544482..545408(+) (amiD) [Streptococcus thermophilus isolate STH_CIRM_1035]
ATGGCTTCAATTGATAAAAGTAAGTTCCAATTTGTAAAGCGCGATGATTTTGCCTCTGAAACAATTGATGCACCGTCTTA
CTCATACTGGAAATCAGTGATGCGTCAATTTTTTAAAAAGAAATCAACAGTTGTAATGTTGGGAATCTTGATTACTATTA
TTTTAATGAGTTTCATCTACCCAATGTTTTCTAAATTTGACTTCAATGATGTCTCAAAAGTAAATGATTTCAGTTTGCGT
TATGTACATCCAAACGCTCAATACTGGTTCGGTACTGACGGTAATGGTAAGTCTCTATTTGACAGTGTTTGGTTTGGGGC
TCGTAATTCTATCCTTATCGCTGTTATCGCTACCTTCCTGAATGTTATAATTGGTTTGCTTGTAGGTGCTGTTTGGGGGA
TTTCTAAGACCTTCGATATGATTATGATGGAAATCTACAACATCATCTCAAATATTCCCTCTCTCCTTGTGGTTATCGTC
TTGACTTACTCATTAGGTGCTGGTTTCTGGAATATGATTTTTGCCATGACCGTAACAGGTTGGATCGGTATTGCCTATAC
AATCCGTATTCAAATCATGCGTTATCGTGATTTGGAGTATAACTTGGCTTCTCGCAATTTGGGAACACCAACGGCTAAGA
TTGTGATTAAAAATATCATGCCACAACTTGTGTCAGTTATTGTAACCATGGCTAGTCAACTTTTGCCAGGATTTATCTCT
TATGAGGCCTTCCTTTCATACTTTGGTTTGGGTCTTCCTGTTACTACGCCTAGTCTTGGTCGTTTGATTTCAGACTATGC
ACAGAACGTTACAGTCAATGCCTATCTCTTCTGGATTCCATTGACTACCTTGATTCTTGTTTCTCTTGCCCTCTTTATTG
TTGGTCAAAACTTAGCGGATGCTAGTGACCCACGTACGCATAGATAG
ATGGCTTCAATTGATAAAAGTAAGTTCCAATTTGTAAAGCGCGATGATTTTGCCTCTGAAACAATTGATGCACCGTCTTA
CTCATACTGGAAATCAGTGATGCGTCAATTTTTTAAAAAGAAATCAACAGTTGTAATGTTGGGAATCTTGATTACTATTA
TTTTAATGAGTTTCATCTACCCAATGTTTTCTAAATTTGACTTCAATGATGTCTCAAAAGTAAATGATTTCAGTTTGCGT
TATGTACATCCAAACGCTCAATACTGGTTCGGTACTGACGGTAATGGTAAGTCTCTATTTGACAGTGTTTGGTTTGGGGC
TCGTAATTCTATCCTTATCGCTGTTATCGCTACCTTCCTGAATGTTATAATTGGTTTGCTTGTAGGTGCTGTTTGGGGGA
TTTCTAAGACCTTCGATATGATTATGATGGAAATCTACAACATCATCTCAAATATTCCCTCTCTCCTTGTGGTTATCGTC
TTGACTTACTCATTAGGTGCTGGTTTCTGGAATATGATTTTTGCCATGACCGTAACAGGTTGGATCGGTATTGCCTATAC
AATCCGTATTCAAATCATGCGTTATCGTGATTTGGAGTATAACTTGGCTTCTCGCAATTTGGGAACACCAACGGCTAAGA
TTGTGATTAAAAATATCATGCCACAACTTGTGTCAGTTATTGTAACCATGGCTAGTCAACTTTTGCCAGGATTTATCTCT
TATGAGGCCTTCCTTTCATACTTTGGTTTGGGTCTTCCTGTTACTACGCCTAGTCTTGGTCGTTTGATTTCAGACTATGC
ACAGAACGTTACAGTCAATGCCTATCTCTTCTGGATTCCATTGACTACCTTGATTCTTGTTTCTCTTGCCCTCTTTATTG
TTGGTCAAAACTTAGCGGATGCTAGTGACCCACGTACGCATAGATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| amiD | Streptococcus thermophilus LMG 18311 |
100 |
100 |
1 |
| amiD | Streptococcus thermophilus LMD-9 |
100 |
100 |
1 |
| amiD | Streptococcus salivarius strain HSISS4 |
96.429 |
100 |
0.964 |