Detailed information    

insolico Bioinformatically predicted

Overview

Name   sepM   Type   Regulator
Locus tag   H1W98_RS08445 Genome accession   NZ_LR822026
Coordinates   1639390..1640466 (-) Length   358 a.a.
NCBI ID   WP_179972223.1    Uniprot ID   A0A7U7C886
Organism   Streptococcus thermophilus isolate STH_CIRM_967     
Function   processing of CSP (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1630735..1696400 1639390..1640466 within 0
IScluster/Tn 1637993..1639243 1639390..1640466 flank 147


Gene organization within MGE regions


Location: 1630735..1696400
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H1W98_RS08410 (STHERMO_1906) - 1631236..1632567 (-) 1332 WP_180482411.1 hemolysin family protein -
  H1W98_RS08415 (STHERMO_1907) - 1632678..1633460 (+) 783 WP_180482410.1 ABC transporter ATP-binding protein -
  H1W98_RS08420 (STHERMO_1910) - 1634079..1636145 (-) 2067 WP_179972221.1 cation:proton antiporter -
  H1W98_RS08425 (STHERMO_1911) - 1636154..1636396 (-) 243 WP_011226461.1 hypothetical protein -
  H1W98_RS08430 (STHERMO_1912) - 1636393..1636941 (-) 549 WP_011226462.1 tRNA (mnm(5)s(2)U34)-methyltransferase -
  H1W98_RS08435 (STHERMO_1913) - 1636938..1637882 (-) 945 WP_179972222.1 TIGR01212 family radical SAM protein -
  H1W98_RS08440 (STHERMO_1915) - 1638041..1639296 (+) 1256 Protein_1614 ISL3 family transposase -
  H1W98_RS08445 (STHERMO_1916) sepM 1639390..1640466 (-) 1077 WP_179972223.1 SepM family pheromone-processing serine protease Regulator
  H1W98_RS08450 (STHERMO_1917) coaD 1640444..1640941 (-) 498 WP_179972224.1 pantetheine-phosphate adenylyltransferase -
  H1W98_RS08455 (STHERMO_1918) rsmD 1640975..1641574 (-) 600 WP_179973963.1 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  H1W98_RS08460 (STHERMO_1919) trxB 1641665..1642618 (-) 954 WP_269473120.1 thioredoxin-disulfide reductase -
  H1W98_RS08465 (STHERMO_1920) - 1642651..1642875 (-) 225 WP_179972227.1 DUF4059 family protein -
  H1W98_RS08470 (STHERMO_1921) - 1643090..1643833 (-) 744 WP_179972228.1 amino acid ABC transporter ATP-binding protein -
  H1W98_RS08475 (STHERMO_1922) - 1643833..1644579 (-) 747 WP_179973030.1 amino acid ABC transporter permease -
  H1W98_RS08480 (STHERMO_1923) - 1644967..1645797 (-) 831 WP_180482409.1 transporter substrate-binding domain-containing protein -
  H1W98_RS08485 (STHERMO_1925) - 1646379..1646612 (-) 234 WP_179972230.1 hypothetical protein -
  H1W98_RS08490 (STHERMO_1926) dinB 1646898..1648001 (-) 1104 WP_180482408.1 DNA polymerase IV -
  H1W98_RS08495 (STHERMO_1928) pflB 1648279..1650587 (+) 2309 Protein_1625 formate C-acetyltransferase -
  H1W98_RS08500 - 1650853..1651635 (+) 783 Protein_1626 carbonic anhydrase -
  H1W98_RS08505 (STHERMO_1931) - 1651686..1652138 (+) 453 WP_180482642.1 GNAT family N-acetyltransferase -
  H1W98_RS08510 (STHERMO_1932) - 1652472..1652813 (-) 342 WP_232086951.1 restriction endonuclease subunit S -
  H1W98_RS11255 mobV 1652819..1653327 (-) 509 Protein_1629 MobV family relaxase -
  H1W98_RS08520 - 1653807..1654401 (-) 595 Protein_1630 site-specific integrase -
  H1W98_RS08525 - 1654615..1655175 (-) 561 WP_232086950.1 hypothetical protein -
  H1W98_RS08530 (STHERMO_1939) - 1655251..1656006 (-) 756 WP_180482407.1 ABC transporter permease -
  H1W98_RS08535 (STHERMO_1940) - 1656003..1656653 (-) 651 WP_180482406.1 ATP-binding cassette domain-containing protein -
  H1W98_RS08540 (STHERMO_1942) - 1656855..1657811 (-) 957 WP_002951776.1 serine hydrolase domain-containing protein -
  H1W98_RS08545 - 1657811..1658566 (-) 756 Protein_1635 CppA family protein -
  H1W98_RS10935 (STHERMO_1946) - 1659048..1659212 (+) 165 WP_232086949.1 type II CAAX prenyl endopeptidase Rce1 family protein -
  H1W98_RS08555 (STHERMO_1947) - 1659410..1660659 (+) 1250 Protein_1637 ISL3 family transposase -
  H1W98_RS08560 (STHERMO_1948) gla 1660718..1661581 (-) 864 WP_002951781.1 aquaglyceroporin Gla -
  H1W98_RS08565 (STHERMO_1949) - 1661702..1663969 (+) 2268 WP_180482405.1 Xaa-Pro dipeptidyl-peptidase -
  H1W98_RS08570 (STHERMO_1950) - 1664049..1664429 (-) 381 WP_180482404.1 bacteriocin secretion protein -
  H1W98_RS08575 - 1664554..1664817 (-) 264 WP_002945924.1 hypothetical protein -
  H1W98_RS08580 (STHERMO_1953) - 1665139..1665435 (-) 297 WP_180482403.1 bacteriocin immunity protein -
  H1W98_RS08585 (STHERMO_1954) - 1665600..1666526 (-) 927 WP_022096485.1 thioredoxin family protein -
  H1W98_RS08590 (STHERMO_1955) - 1666713..1666892 (-) 180 WP_011681564.1 hypothetical protein -
  H1W98_RS08595 (STHERMO_1956) - 1666921..1667313 (-) 393 WP_084829084.1 hypothetical protein -
  H1W98_RS08600 (STHERMO_1957) - 1667325..1667564 (-) 240 WP_021152514.1 Blp family class II bacteriocin -
  H1W98_RS08605 (STHERMO_1960) - 1668150..1668392 (-) 243 WP_180482402.1 Blp family class II bacteriocin -
  H1W98_RS11260 - 1668643..1669044 (-) 402 WP_011226490.1 hypothetical protein -
  H1W98_RS08610 (STHERMO_1966) - 1670068..1670298 (-) 231 WP_011226494.1 bacteriocin class II family protein -
  H1W98_RS08615 (STHERMO_1967) - 1670654..1670854 (-) 201 WP_011681569.1 hypothetical protein -
  H1W98_RS08620 (STHERMO_1968) - 1670873..1671049 (-) 177 WP_180482401.1 Blp family class II bacteriocin -
  H1W98_RS08625 (STHERMO_1969) - 1671300..1672037 (+) 738 WP_180482400.1 LytR/AlgR family response regulator transcription factor -
  H1W98_RS10940 - 1672568..1673371 (+) 804 WP_232086948.1 ATP-binding protein -
  H1W98_RS08635 (STHERMO_1971) - 1673389..1673550 (-) 162 WP_011681573.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  H1W98_RS08640 (STHERMO_1972) - 1673565..1674932 (-) 1368 WP_180482398.1 bacteriocin secretion accessory protein -
  H1W98_RS08645 (STHERMO_1973) comA/nlmT 1674948..1677101 (-) 2154 WP_180482397.1 peptide cleavage/export ABC transporter Regulator
  H1W98_RS08650 (STHERMO_1977) - 1678115..1679860 (-) 1746 WP_180482396.1 ABC transporter ATP-binding protein -
  H1W98_RS08655 (STHERMO_1978) - 1679853..1681610 (-) 1758 WP_100285003.1 ABC transporter ATP-binding protein -
  H1W98_RS10945 (STHERMO_1980) - 1681798..1682004 (-) 207 WP_011681579.1 hypothetical protein -
  H1W98_RS08665 (STHERMO_1981) - 1682209..1682736 (-) 528 WP_011226503.1 VanZ family protein -
  H1W98_RS08670 (STHERMO_1982) rlmN 1682738..1683907 (-) 1170 WP_180482395.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  H1W98_RS08675 (STHERMO_1983) - 1683911..1684633 (-) 723 WP_179972247.1 YutD family protein -
  H1W98_RS08680 (STHERMO_1984) - 1684688..1686043 (-) 1356 WP_179972248.1 bifunctional metallophosphatase/5'-nucleotidase -
  H1W98_RS08685 (STHERMO_1985) - 1686326..1686562 (-) 237 WP_179972249.1 Blp family class II bacteriocin -
  H1W98_RS08690 (STHERMO_1986) - 1686893..1688236 (-) 1344 WP_113870481.1 DEAD/DEAH box helicase -
  H1W98_RS08695 (STHERMO_1987) mraY 1688311..1689333 (-) 1023 WP_011227524.1 phospho-N-acetylmuramoyl-pentapeptide- transferase -
  H1W98_RS08700 (STHERMO_1988) pbp2X 1689335..1691602 (-) 2268 WP_180482394.1 penicillin-binding protein PBP2X -
  H1W98_RS08705 (STHERMO_1989) ftsL 1691606..1691926 (-) 321 WP_002948801.1 cell division protein FtsL -
  H1W98_RS08710 (STHERMO_1990) rsmH 1691929..1692879 (-) 951 WP_180482393.1 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH -
  H1W98_RS10950 (STHERMO_1991) - 1693044..1693472 (-) 429 WP_011681585.1 hypothetical protein -
  H1W98_RS10955 (STHERMO_1992) - 1693438..1693653 (-) 216 WP_011681586.1 hypothetical protein -
  H1W98_RS10960 (STHERMO_1993) - 1693650..1694036 (-) 387 WP_232086248.1 hypothetical protein -
  H1W98_RS11155 (STHERMO_1994) - 1694051..1694182 (-) 132 WP_269473115.1 hypothetical protein -
  H1W98_RS10965 (STHERMO_1995) - 1694256..1694399 (-) 144 WP_014621937.1 hypothetical protein -
  H1W98_RS08725 (STHERMO_1996) - 1694673..1695029 (-) 357 WP_179972253.1 DUF805 domain-containing protein -
  H1W98_RS08730 (STHERMO_1997) - 1695177..1696352 (+) 1176 WP_180482392.1 IS256-like element IS1191 family transposase -

Sequence

Protein


Download         Length: 358 a.a.        Molecular weight: 39237.27 Da        Isoelectric Point: 9.7882

>NTDB_id=1131299 H1W98_RS08445 WP_179972223.1 1639390..1640466(-) (sepM) [Streptococcus thermophilus isolate STH_CIRM_967]
MANKTKSKSLLEKMWRIKWWLLSIFTLLFLLFALFFPLNNYYVELPGGAFDTKEVLTVNKKADDSKGSYNFVAVAQTKAT
LALMLYAKFNDFAKLQTAEEATGNYSDEDFIRINKFYMETSQNQAVYQGLTLAGKEVSLKYMGVYVLQVADDSSFKGVLN
IADTVTAVNGKTFDNSTDMIKYVQGLKLGSKVKVTYMRDGKEKTATGKIIKIANGKNGIGIGLTDHTEIKSPENVKFKLD
GVGGPSAGLIFTLAIYDQVSGQDLKAGRKIAGTGTIEKDGTVGDIGGAYLKVKSAADSGADIFFVPNNLVTKEMKKVDPD
AKTNYQEAKEAAEKLGTKMKIVPVKTAQEAIDYLKKTK

Nucleotide


Download         Length: 1077 bp        

>NTDB_id=1131299 H1W98_RS08445 WP_179972223.1 1639390..1640466(-) (sepM) [Streptococcus thermophilus isolate STH_CIRM_967]
GTGGCAAACAAGACAAAATCTAAATCGCTACTAGAGAAAATGTGGCGTATTAAGTGGTGGTTATTAAGTATTTTTACGTT
ACTTTTCCTCCTTTTTGCCCTCTTTTTCCCTCTCAATAATTACTATGTGGAGCTTCCGGGTGGTGCTTTTGATACCAAGG
AAGTCTTGACAGTGAATAAGAAAGCTGATGATTCTAAGGGCTCCTATAATTTTGTGGCGGTGGCTCAAACCAAGGCGACT
TTGGCCTTGATGCTCTATGCTAAGTTTAATGATTTTGCAAAGCTTCAAACGGCTGAAGAGGCAACTGGAAATTACTCTGA
TGAAGATTTCATACGCATCAACAAATTTTACATGGAGACTTCTCAAAACCAAGCGGTTTATCAGGGCTTGACTCTGGCTG
GTAAGGAGGTTAGTTTGAAGTATATGGGTGTCTATGTGCTTCAGGTTGCTGATGATTCTAGCTTCAAGGGTGTCCTCAAT
ATCGCTGATACGGTGACGGCTGTTAATGGTAAGACCTTTGATAATTCGACTGACATGATTAAATACGTTCAAGGACTTAA
GCTGGGTTCAAAGGTCAAGGTCACTTATATGAGAGATGGTAAAGAAAAGACTGCTACTGGTAAGATTATTAAGATTGCCA
ATGGCAAAAATGGTATTGGTATCGGCCTAACGGACCATACTGAAATTAAGAGTCCTGAGAATGTTAAGTTTAAACTAGAT
GGTGTCGGTGGGCCAAGTGCTGGTCTTATATTTACCTTGGCTATTTACGATCAGGTGTCTGGTCAAGACCTCAAGGCTGG
CCGCAAGATTGCTGGTACAGGAACTATTGAAAAAGATGGGACTGTCGGTGATATCGGTGGGGCCTATCTCAAGGTGAAAT
CTGCGGCTGATAGTGGCGCAGACATTTTCTTCGTGCCAAATAATCTAGTAACTAAGGAAATGAAAAAGGTCGATCCGGAT
GCCAAGACTAATTATCAAGAGGCCAAGGAAGCTGCCGAGAAACTGGGCACCAAGATGAAAATCGTCCCTGTTAAAACAGC
TCAAGAAGCCATTGATTATTTGAAAAAGACTAAATGA

Domains

Predicted by InterproScan.

Lon protease (S16) C-terminal proteolytic domain (Lon_C)

(244-321)

PDZ domain (PDZ_2)

(140-206)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A7U7C886

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sepM Streptococcus mutans UA159

62.463

95.251

0.595

Multiple sequence alignment