Detailed information    

insolico Bioinformatically predicted

Overview

Name   amiD   Type   Regulator
Locus tag   H0507_RS06745 Genome accession   NZ_LR822010
Coordinates   1286823..1287749 (-) Length   308 a.a.
NCBI ID   WP_002946409.1    Uniprot ID   -
Organism   Streptococcus thermophilus isolate STH_CIRM_29     
Function   internalize XIP (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1269272..1341045 1286823..1287749 within 0


Gene organization within MGE regions


Location: 1269272..1341045
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H0507_RS06660 (STHERMO_1461) liaF 1269280..1269978 (-) 699 WP_011226289.1 cell wall-active antibiotics response protein LiaF -
  H0507_RS09890 (STHERMO_1462) - 1270244..1270399 (-) 156 WP_011226290.1 ion channel -
  H0507_RS06670 (STHERMO_1465) stkP/pknB 1271036..1272907 (-) 1872 WP_011226292.1 Stk1 family PASTA domain-containing Ser/Thr kinase Regulator
  H0507_RS06675 (STHERMO_1466) - 1272907..1273644 (-) 738 WP_002946881.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  H0507_RS06680 (STHERMO_1467) rsmB 1273688..1275010 (-) 1323 WP_014608533.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  H0507_RS06685 (STHERMO_1468) fmt 1275000..1275935 (-) 936 WP_002951411.1 methionyl-tRNA formyltransferase -
  H0507_RS06690 (STHERMO_1469) - 1275953..1278349 (-) 2397 WP_011227404.1 primosomal protein N' -
  H0507_RS06695 (STHERMO_1470) rpoZ 1278491..1278805 (-) 315 WP_002951415.1 DNA-directed RNA polymerase subunit omega -
  H0507_RS06700 (STHERMO_1471) gmk 1278827..1279456 (-) 630 WP_011226296.1 guanylate kinase -
  H0507_RS06705 (STHERMO_1472) ftsY 1279689..1281080 (-) 1392 WP_011226297.1 signal recognition particle-docking protein FtsY -
  H0507_RS06710 (STHERMO_1473) - 1281094..1281909 (-) 816 WP_011227405.1 Cof-type HAD-IIB family hydrolase -
  H0507_RS06715 (STHERMO_1474) - 1281902..1282696 (-) 795 WP_059257398.1 HAD hydrolase family protein -
  H0507_RS06720 (STHERMO_1475) - 1282879..1283256 (+) 378 WP_011226300.1 GntR family transcriptional regulator -
  H0507_RS06725 (STHERMO_1476) - 1283261..1283959 (+) 699 WP_011226301.1 ABC transporter ATP-binding protein -
  H0507_RS06730 (STHERMO_1477) - 1283971..1284756 (+) 786 WP_002951425.1 hypothetical protein -
  H0507_RS06735 (STHERMO_1478) amiF 1284806..1285735 (-) 930 WP_002951426.1 ATP-binding cassette domain-containing protein Regulator
  H0507_RS06740 (STHERMO_1479) amiE 1285728..1286813 (-) 1086 WP_011226304.1 ABC transporter ATP-binding protein Regulator
  H0507_RS06745 (STHERMO_1480) amiD 1286823..1287749 (-) 927 WP_002946409.1 oligopeptide ABC transporter permease OppC Regulator
  H0507_RS06750 (STHERMO_1481) amiC 1287749..1289242 (-) 1494 WP_011227407.1 ABC transporter permease Regulator
  H0507_RS06755 (STHERMO_1482) amiA 1289304..1291271 (-) 1968 WP_011226784.1 peptide ABC transporter substrate-binding protein Regulator
  H0507_RS06765 - 1291627..1292876 (+) 1250 Protein_1265 ISL3 family transposase -
  H0507_RS06770 (STHERMO_1484) amiA3 1292921..1294888 (-) 1968 WP_011227411.1 peptide ABC transporter substrate-binding protein Regulator
  H0507_RS06775 - 1295092..1295282 (-) 191 Protein_1267 IS3 family transposase -
  H0507_RS09895 - 1295276..1295686 (-) 411 Protein_1268 ATP-binding cassette domain-containing protein -
  H0507_RS06790 (STHERMO_1487) - 1295718..1296032 (-) 315 Protein_1269 TatD family hydrolase -
  H0507_RS06795 (STHERMO_1488) - 1296381..1297586 (+) 1206 WP_011227415.1 OFA family MFS transporter -
  H0507_RS06800 - 1297632..1298984 (-) 1353 Protein_1271 IS3 family transposase -
  H0507_RS06805 (STHERMO_1493) pta 1299070..1300053 (-) 984 WP_011227420.1 phosphate acetyltransferase -
  H0507_RS06810 (STHERMO_1494) - 1300067..1300963 (-) 897 WP_011226316.1 RluA family pseudouridine synthase -
  H0507_RS06815 (STHERMO_1495) - 1300960..1301796 (-) 837 WP_041827075.1 NAD kinase -
  H0507_RS06820 (STHERMO_1496) - 1301768..1302442 (-) 675 WP_002951443.1 GTP pyrophosphokinase family protein -
  H0507_RS06825 (STHERMO_1497) - 1302538..1303113 (+) 576 WP_002951444.1 CYTH domain-containing protein -
  H0507_RS06830 (STHERMO_1498) - 1303476..1304447 (+) 972 WP_002951446.1 ribose-phosphate diphosphokinase -
  H0507_RS06835 (STHERMO_1499) - 1304451..1305563 (+) 1113 WP_002948029.1 cysteine desulfurase family protein -
  H0507_RS06840 (STHERMO_1500) - 1305565..1305912 (+) 348 WP_002948028.1 DUF1831 domain-containing protein -
  H0507_RS06845 (STHERMO_1501) - 1306056..1306715 (+) 660 WP_041827076.1 redox-sensing transcriptional repressor Rex -
  H0507_RS06850 (STHERMO_1502) - 1306708..1307403 (+) 696 WP_011227423.1 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein -
  H0507_RS06855 (STHERMO_1503) radC 1307456..1308142 (-) 687 WP_011227424.1 RadC family protein -
  H0507_RS06860 (STHERMO_1504) - 1308321..1309661 (-) 1341 WP_231108743.1 DUF2142 domain-containing protein -
  H0507_RS06865 (STHERMO_1505) - 1309810..1311555 (-) 1746 WP_011227426.1 rhamnan synthesis F family protein -
  H0507_RS06870 (STHERMO_1506) - 1311557..1313257 (-) 1701 WP_041827077.1 glycosyltransferase family 4 protein -
  H0507_RS06875 (STHERMO_1507) - 1313275..1314477 (-) 1203 WP_059257395.1 ABC transporter ATP-binding protein -
  H0507_RS06880 (STHERMO_1508) - 1314477..1315283 (-) 807 WP_011227429.1 ABC transporter permease -
  H0507_RS06885 (STHERMO_1509) - 1315283..1316224 (-) 942 WP_011227430.1 glycosyltransferase family 2 protein -
  H0507_RS06890 (STHERMO_1510) cps2T 1316221..1317369 (-) 1149 WP_011227431.1 beta 1-4 rhamnosyltransferase Cps2T -
  H0507_RS06895 (STHERMO_1511) - 1317488..1318270 (-) 783 WP_011227432.1 glycosyltransferase family A protein -
  H0507_RS06900 (STHERMO_1512) - 1318271..1318603 (-) 333 WP_011227433.1 DUF2304 domain-containing protein -
  H0507_RS06905 (STHERMO_1513) - 1318609..1319304 (-) 696 WP_173405413.1 glycosyltransferase family 2 protein -
  H0507_RS06910 - 1319388..1319860 (-) 473 Protein_1293 glycosyltransferase family 2 protein -
  H0507_RS06915 (STHERMO_1516) - 1319925..1320911 (-) 987 WP_011227437.1 glycosyltransferase family 2 protein -
  H0507_RS06920 (STHERMO_1517) - 1320908..1322167 (-) 1260 WP_011227438.1 oligosaccharide flippase family protein -
  H0507_RS06925 (STHERMO_1518) rfbD 1322288..1323139 (-) 852 WP_014621820.1 dTDP-4-dehydrorhamnose reductase -
  H0507_RS06930 (STHERMO_1519) - 1323257..1324183 (-) 927 WP_011227439.1 glycosyltransferase family 2 protein -
  H0507_RS06935 (STHERMO_1520) - 1324193..1324528 (-) 336 WP_002891474.1 metal-sulfur cluster assembly factor -
  H0507_RS06940 (STHERMO_1521) rpoD 1324582..1325691 (-) 1110 WP_011227440.1 RNA polymerase sigma factor RpoD -
  H0507_RS06945 (STHERMO_1522) dnaG 1325695..1327506 (-) 1812 WP_011227441.1 DNA primase -
  H0507_RS06950 (STHERMO_1523) rpsU 1327878..1328054 (-) 177 WP_011226340.1 30S ribosomal protein S21 -
  H0507_RS06955 (STHERMO_1524) - 1328435..1329388 (+) 954 WP_041826943.1 IS30 family transposase -
  H0507_RS06960 (STHERMO_1525) - 1329494..1330288 (-) 795 WP_011227442.1 ABC transporter substrate-binding protein -
  H0507_RS06965 (STHERMO_1526) - 1330381..1331490 (-) 1110 WP_041828295.1 aminotransferase -
  H0507_RS06970 (STHERMO_1527) - 1331837..1332634 (-) 798 WP_059257394.1 transporter substrate-binding domain-containing protein -
  H0507_RS06975 (STHERMO_1528) - 1332631..1333461 (-) 831 WP_041828297.1 transporter substrate-binding domain-containing protein -
  H0507_RS06980 (STHERMO_1529) - 1333675..1334139 (-) 465 WP_011226345.1 8-oxo-dGTP diphosphatase -
  H0507_RS06985 (STHERMO_1530) uvrB 1334184..1336175 (-) 1992 WP_002953358.1 excinuclease ABC subunit UvrB -
  H0507_RS09900 - 1336322..1336567 (-) 246 WP_231779859.1 hypothetical protein -
  H0507_RS10220 - 1336862..1337798 (-) 937 Protein_1310 CPBP family intramembrane glutamic endopeptidase -
  H0507_RS07000 (STHERMO_1535) - 1337997..1340207 (+) 2211 WP_011226350.1 ABC transporter substrate-binding protein/permease -
  H0507_RS07005 (STHERMO_1536) - 1340207..1340947 (+) 741 WP_002945131.1 amino acid ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 308 a.a.        Molecular weight: 34694.85 Da        Isoelectric Point: 9.7054

>NTDB_id=1130623 H0507_RS06745 WP_002946409.1 1286823..1287749(-) (amiD) [Streptococcus thermophilus isolate STH_CIRM_29]
MASIDKSKFQFVKRDDFASETIDAPSYSYWKSVMRQFFKKKSTVVMLGILITIILMSFIYPMFSKFDFNDVSKVNDFSLR
YVHPNAQYWFGTDGNGKSLFDSVWFGARNSILIAVIATFLNVIIGLLVGAVWGISKTFDMIMMEIYNIISNIPSLLVVIV
LTYSLGAGFWNMIFAMTVTGWIGIAYTIRIQIMRYRDLEYNLASRNLGTPTAKIVIKNIMPQLVSVIVTMASQLLPGFIS
YEAFLSYFGLGLPVTTPSLGRLISDYAQNVTVNAYLFWIPLTTLILVSLALFIVGQNLADASDPRTHR

Nucleotide


Download         Length: 927 bp        

>NTDB_id=1130623 H0507_RS06745 WP_002946409.1 1286823..1287749(-) (amiD) [Streptococcus thermophilus isolate STH_CIRM_29]
ATGGCTTCAATTGATAAAAGTAAGTTCCAATTTGTAAAGCGCGATGATTTTGCCTCTGAAACAATTGATGCACCGTCTTA
CTCATACTGGAAATCAGTGATGCGTCAATTTTTTAAAAAGAAATCAACAGTTGTAATGTTGGGAATCTTGATTACTATTA
TTTTAATGAGTTTCATCTACCCAATGTTTTCTAAATTTGACTTCAATGATGTCTCAAAAGTAAATGATTTCAGTTTGCGT
TATGTACATCCAAACGCTCAATACTGGTTCGGTACTGACGGTAATGGTAAGTCTCTATTTGACAGTGTTTGGTTTGGGGC
TCGTAATTCTATCCTTATCGCTGTTATCGCTACCTTCCTGAATGTTATAATTGGTTTGCTTGTAGGTGCTGTTTGGGGGA
TTTCTAAGACCTTCGATATGATTATGATGGAAATCTACAACATCATCTCAAATATTCCCTCTCTCCTTGTGGTTATCGTC
TTGACTTACTCATTAGGTGCTGGTTTCTGGAATATGATTTTTGCCATGACCGTAACAGGTTGGATCGGTATTGCCTATAC
AATCCGTATTCAAATCATGCGTTATCGTGATTTGGAGTATAACTTGGCTTCTCGCAATTTGGGAACACCAACGGCTAAGA
TTGTGATTAAAAATATCATGCCACAACTTGTGTCAGTTATTGTAACCATGGCTAGTCAACTTTTGCCAGGATTTATCTCT
TATGAGGCCTTCCTTTCATACTTTGGTTTGGGTCTTCCTGTTACTACGCCTAGTCTTGGTCGTTTGATTTCAGACTATGC
ACAGAACGTTACAGTCAATGCCTATCTCTTCTGGATTCCATTGACTACCTTGATTCTTGTTTCTCTTGCCCTCTTTATTG
TTGGTCAAAACTTAGCGGATGCTAGTGACCCACGTACGCATAGATAG

Domains

Predicted by InterproScan.

N-terminal TM domain of oligopeptide transport permease C (OppC_N)

(28-71)

Binding-protein-dependent transport system inner membrane component (BPD_transp_1)

(125-306)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  amiD Streptococcus thermophilus LMG 18311

100

100

1
  amiD Streptococcus thermophilus LMD-9

100

100

1
  amiD Streptococcus salivarius strain HSISS4

96.429

100

0.964

Multiple sequence alignment