Detailed information    

insolico Bioinformatically predicted

Overview

Name   sepM   Type   Regulator
Locus tag   H0501_RS07835 Genome accession   NZ_LR822008
Coordinates   1522252..1523328 (-) Length   358 a.a.
NCBI ID   WP_011681549.1    Uniprot ID   -
Organism   Streptococcus thermophilus isolate STH_CIRM_18     
Function   processing of CSP (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1507521..1580330 1522252..1523328 within 0


Gene organization within MGE regions


Location: 1507521..1580330
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H0501_RS07770 (STHERMO_1722) - 1508411..1508962 (-) 552 WP_002946999.1 cysteine hydrolase family protein -
  H0501_RS07775 (STHERMO_1723) codY 1509025..1509810 (-) 786 WP_002951720.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  H0501_RS07780 (STHERMO_1724) - 1510070..1511284 (-) 1215 WP_011226456.1 pyridoxal phosphate-dependent aminotransferase -
  H0501_RS07785 (STHERMO_1725) - 1511639..1512091 (+) 453 WP_179970584.1 universal stress protein -
  H0501_RS10115 - 1512273..1512844 (+) 572 Protein_1498 IS30 family transposase -
  H0501_RS10120 (STHERMO_1727) - 1512916..1513512 (-) 597 WP_232086461.1 hypothetical protein -
  H0501_RS07795 (STHERMO_1729) pflA 1513724..1514524 (-) 801 WP_002946980.1 pyruvate formate-lyase-activating protein -
  H0501_RS07800 - 1514712..1514822 (-) 111 WP_014621906.1 LPXTG cell wall anchor domain-containing protein -
  H0501_RS07805 (STHERMO_1731) - 1515520..1516851 (-) 1332 WP_002951727.1 hemolysin family protein -
  H0501_RS07810 (STHERMO_1732) - 1516963..1517745 (+) 783 WP_011226459.1 ABC transporter ATP-binding protein -
  H0501_RS07815 (STHERMO_1734) - 1518364..1520430 (-) 2067 WP_179970583.1 cation:proton antiporter -
  H0501_RS07820 (STHERMO_1735) - 1520439..1520681 (-) 243 WP_011226461.1 hypothetical protein -
  H0501_RS07825 (STHERMO_1736) - 1520678..1521226 (-) 549 WP_011226462.1 tRNA (mnm(5)s(2)U34)-methyltransferase -
  H0501_RS07830 (STHERMO_1737) - 1521223..1522167 (-) 945 WP_011226463.1 TIGR01212 family radical SAM protein -
  H0501_RS07835 (STHERMO_1738) sepM 1522252..1523328 (-) 1077 WP_011681549.1 SepM family pheromone-processing serine protease Regulator
  H0501_RS07840 (STHERMO_1739) coaD 1523306..1523803 (-) 498 WP_011681550.1 pantetheine-phosphate adenylyltransferase -
  H0501_RS07845 (STHERMO_1740) rsmD 1523837..1524436 (-) 600 Protein_1510 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  H0501_RS07850 (STHERMO_1741) trxB 1524527..1525480 (-) 954 WP_255136104.1 thioredoxin-disulfide reductase -
  H0501_RS07855 (STHERMO_1742) - 1525513..1525737 (-) 225 WP_087010135.1 DUF4059 family protein -
  H0501_RS07860 (STHERMO_1743) - 1525952..1526695 (-) 744 WP_084829069.1 amino acid ABC transporter ATP-binding protein -
  H0501_RS07865 (STHERMO_1744) - 1526695..1527441 (-) 747 WP_179970821.1 amino acid ABC transporter permease -
  H0501_RS07870 (STHERMO_1745) - 1527837..1528667 (-) 831 WP_041828322.1 transporter substrate-binding domain-containing protein -
  H0501_RS07875 (STHERMO_1747) - 1529126..1529359 (-) 234 WP_002947030.1 hypothetical protein -
  H0501_RS07880 (STHERMO_1748) dinB 1529657..1530760 (-) 1104 WP_014608654.1 DNA polymerase IV -
  H0501_RS07885 (STHERMO_1749) pflB 1531039..1533348 (+) 2310 WP_179970842.1 formate C-acetyltransferase -
  H0501_RS07890 (STHERMO_1750) - 1533615..1534397 (+) 783 WP_011681555.1 carbonic anhydrase -
  H0501_RS07895 (STHERMO_1751) - 1534448..1534900 (+) 453 WP_179970582.1 GNAT family N-acetyltransferase -
  H0501_RS07900 (STHERMO_1752) - 1535251..1535535 (-) 285 WP_014608656.1 restriction endonuclease subunit S -
  H0501_RS10445 (STHERMO_1754) mobV 1535581..1536089 (-) 509 Protein_1522 MobV family relaxase -
  H0501_RS07910 (STHERMO_1756) - 1536534..1537289 (-) 756 WP_011681558.1 ABC transporter permease -
  H0501_RS07915 (STHERMO_1757) - 1537286..1537936 (-) 651 WP_011681559.1 ATP-binding cassette domain-containing protein -
  H0501_RS07920 (STHERMO_1759) - 1538139..1539095 (-) 957 WP_002951776.1 serine hydrolase domain-containing protein -
  H0501_RS07925 (STHERMO_1760) - 1539095..1539850 (-) 756 WP_011681560.1 CppA family protein -
  H0501_RS07930 (STHERMO_1761) - 1540132..1540494 (+) 363 WP_014608659.1 CPBP family intramembrane glutamic endopeptidase -
  H0501_RS07935 (STHERMO_1762) gla 1540581..1541444 (-) 864 WP_002951781.1 aquaglyceroporin Gla -
  H0501_RS07940 (STHERMO_1763) - 1541565..1543832 (+) 2268 WP_179970581.1 Xaa-Pro dipeptidyl-peptidase -
  H0501_RS07945 (STHERMO_1764) - 1543912..1544292 (-) 381 WP_002951783.1 hypothetical protein -
  H0501_RS07950 - 1544417..1544680 (-) 264 WP_002945924.1 hypothetical protein -
  H0501_RS07955 - 1545002..1545241 (-) 240 WP_224103609.1 bacteriocin immunity protein -
  H0501_RS07960 (STHERMO_1768) - 1545463..1545669 (-) 207 WP_011681562.1 hypothetical protein -
  H0501_RS07965 (STHERMO_1769) - 1545700..1546389 (-) 690 WP_011681563.1 thioredoxin family protein -
  H0501_RS07970 - 1546583..1548153 (+) 1571 WP_087009847.1 IS3-like element ISSth1b family transposase -
  H0501_RS07975 (STHERMO_1772) - 1548299..1548565 (-) 267 WP_179970580.1 bacteriocin -
  H0501_RS10450 (STHERMO_1773) - 1548816..1549217 (-) 402 WP_024703992.1 hypothetical protein -
  H0501_RS07980 (STHERMO_1778) - 1550222..1550452 (-) 231 WP_014608662.1 bacteriocin class II family protein -
  H0501_RS07985 (STHERMO_1779) - 1550808..1551008 (-) 201 WP_011681569.1 hypothetical protein -
  H0501_RS07990 (STHERMO_1780) - 1551027..1551203 (-) 177 WP_011681570.1 Blp family class II bacteriocin -
  H0501_RS07995 (STHERMO_1781) - 1551459..1552190 (+) 732 WP_002948869.1 LytR/AlgR family response regulator transcription factor -
  H0501_RS10130 - 1552727..1553530 (+) 804 WP_224102945.1 ATP-binding protein -
  H0501_RS08005 (STHERMO_1783) - 1553548..1553709 (-) 162 WP_011681573.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  H0501_RS08010 (STHERMO_1784) - 1553724..1555091 (-) 1368 WP_011681574.1 bacteriocin secretion accessory protein -
  H0501_RS08015 (STHERMO_1785) comA/nlmT 1555107..1557260 (-) 2154 WP_041827378.1 peptide cleavage/export ABC transporter Regulator
  H0501_RS08020 (STHERMO_1788) - 1558274..1560019 (-) 1746 WP_024703994.1 ABC transporter ATP-binding protein -
  H0501_RS08025 (STHERMO_1789) - 1560012..1561769 (-) 1758 WP_014608668.1 ABC transporter ATP-binding protein -
  H0501_RS10135 (STHERMO_1791) - 1561957..1562163 (-) 207 WP_002948879.1 hypothetical protein -
  H0501_RS08035 (STHERMO_1792) - 1562368..1562895 (-) 528 WP_011226503.1 VanZ family protein -
  H0501_RS08040 (STHERMO_1793) rlmN 1562897..1564066 (-) 1170 WP_011226504.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  H0501_RS08045 (STHERMO_1794) - 1564070..1564792 (-) 723 WP_011226505.1 YutD family protein -
  H0501_RS08050 (STHERMO_1795) - 1564847..1566202 (-) 1356 WP_002948886.1 bifunctional metallophosphatase/5'-nucleotidase -
  H0501_RS08055 (STHERMO_1798) - 1567050..1568393 (-) 1344 WP_014608670.1 DEAD/DEAH box helicase -
  H0501_RS08060 (STHERMO_1799) mraY 1568468..1569490 (-) 1023 WP_011227524.1 phospho-N-acetylmuramoyl-pentapeptide- transferase -
  H0501_RS08065 (STHERMO_1800) pbp2X 1569492..1571759 (-) 2268 WP_179970579.1 penicillin-binding protein PBP2X -
  H0501_RS08070 (STHERMO_1801) ftsL 1571763..1572083 (-) 321 WP_014608671.1 cell division protein FtsL -
  H0501_RS08075 (STHERMO_1802) rsmH 1572086..1573036 (-) 951 WP_002888254.1 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH -
  H0501_RS08080 (STHERMO_1803) - 1573203..1573937 (-) 735 WP_224103476.1 hypothetical protein -
  H0501_RS10140 (STHERMO_1805) - 1574263..1574526 (+) 264 WP_162877224.1 hypothetical protein -
  H0501_RS08095 (STHERMO_1807) - 1574832..1575188 (-) 357 WP_023909925.1 DUF805 domain-containing protein -
  H0501_RS08100 (STHERMO_1808) - 1575537..1575704 (-) 168 WP_153300736.1 hypothetical protein -
  H0501_RS08105 (STHERMO_1809) - 1576037..1577287 (-) 1251 WP_014608675.1 glutamate-5-semialdehyde dehydrogenase -
  H0501_RS08110 (STHERMO_1810) proB 1577289..1578092 (-) 804 WP_014608676.1 glutamate 5-kinase -
  H0501_RS08115 (STHERMO_1811) - 1578213..1579802 (-) 1590 WP_014608677.1 ABC transporter permease -

Sequence

Protein


Download         Length: 358 a.a.        Molecular weight: 39172.02 Da        Isoelectric Point: 9.3888

>NTDB_id=1130515 H0501_RS07835 WP_011681549.1 1522252..1523328(-) (sepM) [Streptococcus thermophilus isolate STH_CIRM_18]
MANKTKSKALLEKMWRIKWWLLSIFTVLFLLFALFFPLNNYYVELPGGAFDTKEVLTVNKKADDSKGSYNFVAVAQTKAT
LALMLYAQFNDFAKLQTAEEATGNYSDEDFMRINQFYMETSQNQAVYQGLTLAGKEVSLEYMGVYVLQVADDSSFKGVLN
IADTVTAVNGNTFDNSTDMIKYVQGLKLGSKVKVTYMRDGKEKTATGKIIKIANGKNGIGIGLTDHTEIKSPENVKFKLD
GVGGPSAGLMFTLAIYDQVSGQDLKAGRKIAGTGTIEKDGAVGDIGGAYLKVKSAADSGADIFFVPNNLVTKEMKKADPD
AKTNYQEAKEAAEKLGTKMKIVPVKTAQEAIDYLKKTK

Nucleotide


Download         Length: 1077 bp        

>NTDB_id=1130515 H0501_RS07835 WP_011681549.1 1522252..1523328(-) (sepM) [Streptococcus thermophilus isolate STH_CIRM_18]
GTGGCAAACAAGACAAAATCTAAAGCGCTATTAGAGAAAATGTGGCGTATTAAGTGGTGGTTATTAAGTATTTTTACGGT
ACTTTTCCTCCTTTTTGCCCTCTTTTTCCCGCTCAATAATTACTATGTGGAGCTTCCGGGTGGTGCTTTTGATACCAAGG
AAGTCTTGACAGTGAATAAGAAAGCTGATGATTCTAAGGGCTCCTATAATTTTGTGGCGGTGGCTCAAACCAAGGCGACT
TTGGCCTTGATGCTCTATGCTCAGTTTAATGATTTTGCAAAGCTTCAAACGGCTGAAGAGGCAACTGGAAATTACTCTGA
TGAAGATTTCATGCGCATCAACCAATTTTACATGGAGACTTCTCAAAACCAAGCGGTTTATCAGGGCTTGACTCTGGCTG
GTAAGGAGGTTAGTTTGGAGTATATGGGTGTCTATGTGCTTCAGGTTGCTGATGATTCTAGCTTCAAGGGTGTCCTCAAT
ATTGCTGATACGGTGACGGCTGTTAATGGTAATACCTTTGATAATTCTACTGACATGATTAAATACGTTCAAGGACTTAA
GCTGGGTTCAAAGGTCAAGGTCACTTATATGAGAGATGGCAAAGAAAAGACTGCTACTGGTAAGATTATTAAGATTGCCA
ATGGCAAAAATGGTATTGGTATCGGCCTAACGGACCATACTGAGATCAAGAGTCCTGAGAATGTTAAGTTTAAACTGGAT
GGTGTCGGTGGGCCAAGTGCTGGTCTTATGTTTACCTTGGCTATTTACGATCAGGTGTCTGGTCAAGACCTCAAGGCTGG
CCGCAAGATTGCTGGTACAGGAACTATTGAAAAAGATGGGGCTGTCGGTGATATCGGTGGGGCCTATCTCAAGGTGAAAT
CTGCGGCTGATAGTGGCGCAGACATTTTCTTCGTGCCAAATAATCTAGTAACTAAGGAAATGAAAAAGGCTGATCCGGAT
GCCAAGACTAATTATCAAGAGGCCAAGGAAGCTGCCGAGAAACTGGGGACCAAGATGAAAATCGTCCCTGTTAAAACAGC
TCAAGAAGCCATTGATTATTTGAAAAAGACTAAATGA

Domains

Predicted by InterproScan.

PDZ domain (PDZ_2)

(137-206)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sepM Streptococcus mutans UA159

62.757

95.251

0.598

Multiple sequence alignment