Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   BAMY6639_RS12650 Genome accession   NZ_CP006058
Coordinates   2616110..2616229 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus amyloliquefaciens UMAF6639     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 2611110..2621229
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMY6639_RS12635 (BAMY6639_13260) - 2612723..2613406 (+) 684 WP_007410267.1 response regulator transcription factor -
  BAMY6639_RS12640 (BAMY6639_13265) - 2613393..2614826 (+) 1434 WP_162492834.1 sensor histidine kinase -
  BAMY6639_RS12645 (BAMY6639_13270) rapC 2614978..2616126 (+) 1149 WP_033575082.1 Rap family tetratricopeptide repeat protein Regulator
  BAMY6639_RS12650 (BAMY6639_13275) phrC 2616110..2616229 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  BAMY6639_RS19750 - 2616377..2616487 (-) 111 WP_370529518.1 YjcZ family sporulation protein -
  BAMY6639_RS12655 (BAMY6639_13285) - 2616567..2617931 (-) 1365 WP_061861151.1 aspartate kinase -
  BAMY6639_RS12660 (BAMY6639_13290) ceuB 2618345..2619298 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  BAMY6639_RS12665 (BAMY6639_13295) - 2619288..2620235 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  BAMY6639_RS12670 (BAMY6639_13300) - 2620229..2620987 (+) 759 WP_061861152.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=112988 BAMY6639_RS12650 WP_003156334.1 2616110..2616229(+) (phrC) [Bacillus amyloliquefaciens UMAF6639]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=112988 BAMY6639_RS12650 WP_003156334.1 2616110..2616229(+) (phrC) [Bacillus amyloliquefaciens UMAF6639]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment