Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   M036_RS16235 Genome accession   NZ_CP005997
Coordinates   3101594..3101734 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis TO-A     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3096594..3106734
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M036_RS16210 (M036_16180) yuxO 3096944..3097324 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  M036_RS16215 (M036_16185) comA 3097343..3097987 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  M036_RS16220 (M036_16190) - 3098068..3100365 (-) 2298 Protein_3146 histidine kinase -
  M036_RS16225 (M036_16195) comX 3100373..3100534 (-) 162 WP_003228803.1 competence pheromone ComX -
  M036_RS16230 (M036_16200) - 3100549..3101409 (-) 861 WP_029318489.1 polyprenyl synthetase family protein -
  M036_RS16235 (M036_16205) degQ 3101594..3101734 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  M036_RS21830 - 3101956..3102081 (+) 126 WP_003228793.1 hypothetical protein -
  M036_RS16240 (M036_16210) - 3102195..3102563 (+) 369 WP_014477834.1 hypothetical protein -
  M036_RS16245 (M036_16215) pdeH 3102539..3103768 (-) 1230 WP_003228790.1 cyclic di-GMP phosphodiesterase -
  M036_RS16250 (M036_16220) pncB 3103905..3105377 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  M036_RS16255 (M036_16225) pncA 3105393..3105944 (-) 552 WP_048217610.1 isochorismatase family cysteine hydrolase -
  M036_RS16260 (M036_16230) yueI 3106041..3106439 (-) 399 WP_019712929.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=112843 M036_RS16235 WP_003220708.1 3101594..3101734(-) (degQ) [Bacillus subtilis TO-A]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=112843 M036_RS16235 WP_003220708.1 3101594..3101734(-) (degQ) [Bacillus subtilis TO-A]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment