Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   FJH52_RS02670 Genome accession   NZ_LR595848
Coordinates   522983..523132 (+) Length   49 a.a.
NCBI ID   WP_001813641.1    Uniprot ID   A0A6I3TPS6
Organism   Streptococcus pneumoniae strain 4559 isolate 4559     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 521259..522064 522983..523132 flank 919


Gene organization within MGE regions


Location: 521259..523132
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FJH52_RS02655 - 521259..522064 (+) 806 Protein_532 IS5 family transposase -
  FJH52_RS02660 blpM 522266..522520 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  FJH52_RS02665 blpN 522536..522739 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  FJH52_RS02670 cipB 522983..523132 (+) 150 WP_001813641.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5164.93 Da        Isoelectric Point: 3.9133

>NTDB_id=1128314 FJH52_RS02670 WP_001813641.1 522983..523132(+) (cipB) [Streptococcus pneumoniae strain 4559 isolate 4559]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=1128314 FJH52_RS02670 WP_001813641.1 522983..523132(+) (cipB) [Streptococcus pneumoniae strain 4559 isolate 4559]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I3TPS6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

48.98

100

0.49

Multiple sequence alignment