Detailed information    

insolico Bioinformatically predicted

Overview

Name   comS   Type   Regulator
Locus tag   FGL18_RS10800 Genome accession   NZ_LR594046
Coordinates   57172..57270 (+) Length   32 a.a.
NCBI ID   WP_014611913.1    Uniprot ID   A0A380JYX6
Organism   Streptococcus dysgalactiae strain NCTC6403     
Function   activate transcription of comX (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 45110..61070 57172..57270 within 0


Gene organization within MGE regions


Location: 45110..61070
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FGL18_RS00305 (NCTC6403_00061) purM 45110..46138 (+) 1029 WP_003062570.1 phosphoribosylformylglycinamidine cyclo-ligase -
  FGL18_RS00310 (NCTC6403_00062) purN 46131..46685 (+) 555 WP_138124335.1 phosphoribosylglycinamide formyltransferase -
  FGL18_RS00315 (NCTC6403_00063) purH 46736..48280 (+) 1545 WP_138124338.1 bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase -
  FGL18_RS00320 (NCTC6403_00064) - 48360..49487 (-) 1128 WP_138124341.1 SH3 domain-containing protein -
  FGL18_RS00325 (NCTC6403_00065) purD 49769..51031 (+) 1263 WP_138124344.1 phosphoribosylamine--glycine ligase -
  FGL18_RS00330 (NCTC6403_00066) purE 51674..52162 (+) 489 WP_138124348.1 5-(carboxyamino)imidazole ribonucleotide mutase -
  FGL18_RS00335 (NCTC6403_00067) purK 52149..53222 (+) 1074 WP_138124351.1 5-(carboxyamino)imidazole ribonucleotide synthase -
  FGL18_RS00340 (NCTC6403_00068) - 53232..54488 (+) 1257 WP_138124354.1 DUF4041 domain-containing protein -
  FGL18_RS00345 - 54481..54690 (+) 210 WP_138124357.1 hypothetical protein -
  FGL18_RS00350 (NCTC6403_00069) purB 54739..56031 (+) 1293 WP_138124360.1 adenylosuccinate lyase -
  FGL18_RS00355 (NCTC6403_00070) comR 56173..57084 (+) 912 WP_138124363.1 XRE family transcriptional regulator Regulator
  FGL18_RS10800 (NCTC6403_00071) comS 57172..57270 (+) 99 WP_014611913.1 quorum-sensing system DWW-type pheromone Regulator
  FGL18_RS00360 (NCTC6403_00072) ruvB 57304..58302 (+) 999 WP_129555156.1 Holliday junction branch migration DNA helicase RuvB -
  FGL18_RS00365 (NCTC6403_00073) - 58437..58868 (+) 432 WP_111714695.1 low molecular weight protein-tyrosine-phosphatase -
  FGL18_RS00370 (NCTC6403_00074) - 58897..59298 (+) 402 WP_003049089.1 MORN repeat-containing protein -
  FGL18_RS00375 (NCTC6403_00075) - 59295..61070 (+) 1776 WP_138124366.1 acyltransferase family protein -

Sequence

Protein


Download         Length: 32 a.a.        Molecular weight: 3771.59 Da        Isoelectric Point: 10.4764

>NTDB_id=1127828 FGL18_RS10800 WP_014611913.1 57172..57270(+) (comS) [Streptococcus dysgalactiae strain NCTC6403]
MFKKIKPYLLLAAVVAFKVARAMNEFDWWNLG

Nucleotide


Download         Length: 99 bp        

>NTDB_id=1127828 FGL18_RS10800 WP_014611913.1 57172..57270(+) (comS) [Streptococcus dysgalactiae strain NCTC6403]
ATGTTTAAAAAAATCAAACCATATTTGTTATTAGCCGCAGTCGTTGCTTTCAAAGTTGCTCGTGCAATGAACGAATTTGA
TTGGTGGAACCTAGGGTGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A380JYX6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comS Streptococcus pyogenes MGAS315

84.375

100

0.844
  comS Streptococcus pyogenes MGAS8232

45.161

96.875

0.437

Multiple sequence alignment