Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   BTK_RS02355 Genome accession   NZ_CP004870
Coordinates   422348..422626 (+) Length   92 a.a.
NCBI ID   WP_000799098.1    Uniprot ID   A0A9W5VHK7
Organism   Bacillus thuringiensis serovar kurstaki str. HD-1     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Genomic Context

Location: 417348..427626
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BTK_RS02310 (BTK_02050) - 417391..418530 (+) 1140 WP_000838797.1 AimR family lysis-lysogeny pheromone receptor -
  BTK_RS37370 - 418527..418676 (+) 150 WP_002134067.1 hypothetical protein -
  BTK_RS38645 - 418902..419024 (+) 123 WP_000237930.1 hypothetical protein -
  BTK_RS02315 (BTK_02055) - 419044..419397 (-) 354 WP_000172107.1 helix-turn-helix transcriptional regulator -
  BTK_RS02320 (BTK_02060) - 419610..419861 (+) 252 WP_228244385.1 helix-turn-helix transcriptional regulator -
  BTK_RS02325 (BTK_02065) - 419858..420208 (+) 351 WP_001246222.1 helix-turn-helix domain-containing protein -
  BTK_RS02330 (BTK_02070) - 420205..420372 (+) 168 WP_000969632.1 hypothetical protein -
  BTK_RS37375 (BTK_02075) - 420402..420578 (+) 177 WP_001084331.1 hypothetical protein -
  BTK_RS02340 (BTK_02080) - 420583..421323 (+) 741 WP_000190244.1 DnaD domain protein -
  BTK_RS02345 (BTK_02085) - 421271..422134 (+) 864 WP_001148230.1 ATP-binding protein -
  BTK_RS02350 (BTK_02090) - 422137..422331 (+) 195 WP_000337984.1 hypothetical protein -
  BTK_RS02355 (BTK_02095) abrB 422348..422626 (+) 279 WP_000799098.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  BTK_RS02360 (BTK_02100) - 422619..422978 (+) 360 WP_001125972.1 hypothetical protein -
  BTK_RS02365 (BTK_02105) - 422997..423164 (+) 168 WP_000717829.1 DUF3954 domain-containing protein -
  BTK_RS02370 (BTK_02110) - 423190..423441 (+) 252 WP_000109543.1 hypothetical protein -
  BTK_RS02375 (BTK_02115) - 423461..423970 (+) 510 WP_001054607.1 dUTP diphosphatase -
  BTK_RS02380 (BTK_02120) - 424011..424484 (+) 474 WP_001134294.1 hypothetical protein -
  BTK_RS02385 (BTK_02125) - 424481..424918 (+) 438 WP_002134064.1 hypothetical protein -
  BTK_RS02390 (BTK_02130) - 424954..425151 (+) 198 WP_000323893.1 hypothetical protein -
  BTK_RS02395 (BTK_02135) - 425144..425677 (+) 534 WP_001030635.1 hypothetical protein -
  BTK_RS02400 (BTK_02140) - 425716..426090 (+) 375 WP_228161154.1 hypothetical protein -
  BTK_RS02405 (BTK_02145) - 426134..426406 (+) 273 WP_001268380.1 hypothetical protein -
  BTK_RS02410 (BTK_02150) - 426446..426655 (+) 210 WP_000670920.1 hypothetical protein -
  BTK_RS37380 (BTK_02155) - 426686..426853 (+) 168 WP_000539656.1 hypothetical protein -
  BTK_RS02415 (BTK_02160) - 426997..427425 (+) 429 WP_000350118.1 hypothetical protein -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 9941.45 Da        Isoelectric Point: 5.1782

>NTDB_id=112465 BTK_RS02355 WP_000799098.1 422348..422626(+) (abrB) [Bacillus thuringiensis serovar kurstaki str. HD-1]
MKNTGVSRKVDELGRVVIPVELRRNLGIVEGTALGFHVEGENIVLKKQDKSCFVTGEVSESNIELLEGRMFLSKEGASEL
LGAIEKSGIVNA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=112465 BTK_RS02355 WP_000799098.1 422348..422626(+) (abrB) [Bacillus thuringiensis serovar kurstaki str. HD-1]
ATGAAAAACACAGGTGTTTCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAGTAGAGTTACGCAGAAATTTAGG
AATTGTTGAAGGTACAGCATTAGGATTTCATGTTGAAGGGGAAAACATCGTTTTAAAAAAACAGGATAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAATCAAACATAGAGTTGCTAGAGGGTCGGATGTTTTTAAGTAAGGAAGGTGCAAGTGAGTTG
CTGGGCGCTATTGAGAAGAGTGGGATTGTAAATGCCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-48)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.322

94.565

0.533

Multiple sequence alignment