Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   EL190_RS02095 Genome accession   NZ_LR134395
Coordinates   389473..390126 (-) Length   217 a.a.
NCBI ID   WP_006995324.1    Uniprot ID   -
Organism   Haemophilus aegyptius strain NCTC8134     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 348395..392484 389473..390126 within 0


Gene organization within MGE regions


Location: 348395..392484
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL190_RS01800 (NCTC8134_00366) - 348395..349405 (-) 1011 WP_006995367.1 phage portal protein -
  EL190_RS01805 (NCTC8134_00368) - 349415..351193 (-) 1779 Protein_357 terminase large subunit domain-containing protein -
  EL190_RS01815 (NCTC8134_00371) - 351618..352262 (+) 645 WP_006995363.1 phage repressor protein -
  EL190_RS01820 (NCTC8134_00372) - 352440..353255 (+) 816 WP_006995362.1 GPO family capsid scaffolding protein -
  EL190_RS01825 (NCTC8134_00373) - 353277..354326 (+) 1050 WP_006995361.1 phage major capsid protein, P2 family -
  EL190_RS01830 (NCTC8134_00374) gpM 354338..354988 (+) 651 WP_006995360.1 phage terminase small subunit -
  EL190_RS01835 (NCTC8134_00375) - 355281..355787 (+) 507 WP_006995358.1 head completion/stabilization protein -
  EL190_RS01840 (NCTC8134_00376) - 355787..355996 (+) 210 WP_005668467.1 tail protein X -
  EL190_RS01845 (NCTC8134_00377) - 355998..356219 (+) 222 WP_006995357.1 phage holin -
  EL190_RS01850 (NCTC8134_00378) - 356212..356730 (+) 519 WP_005653059.1 lysozyme -
  EL190_RS01855 (NCTC8134_00379) - 356715..357065 (+) 351 WP_006995356.1 hypothetical protein -
  EL190_RS10380 lysC 356980..357243 (+) 264 WP_005672206.1 Rz1-like lysis system protein LysC -
  EL190_RS01865 (NCTC8134_00380) - 357240..357455 (+) 216 WP_006995354.1 TraR/DksA family transcriptional regulator -
  EL190_RS01870 (NCTC8134_00381) - 357452..357922 (+) 471 WP_006995353.1 phage tail protein -
  EL190_RS01875 (NCTC8134_00382) - 357922..358380 (+) 459 WP_006995352.1 phage virion morphogenesis protein -
  EL190_RS01880 (NCTC8134_00383) - 358358..358630 (-) 273 WP_006995351.1 hypothetical protein -
  EL190_RS01885 (NCTC8134_00384) - 358700..361435 (+) 2736 WP_006995350.1 phage tail tape measure protein -
  EL190_RS10170 (NCTC8134_00385) - 361512..361679 (+) 168 WP_006995349.1 hypothetical protein -
  EL190_RS01890 (NCTC8134_00386) - 361657..362109 (+) 453 WP_006995348.1 hypothetical protein -
  EL190_RS01895 (NCTC8134_00387) - 362210..362809 (+) 600 WP_005668437.1 phage baseplate assembly protein V -
  EL190_RS01900 (NCTC8134_00388) - 362811..363149 (+) 339 WP_005633786.1 GPW/gp25 family protein -
  EL190_RS01905 (NCTC8134_00389) - 363146..364060 (+) 915 WP_006995347.1 baseplate J/gp47 family protein -
  EL190_RS01910 (NCTC8134_00390) - 364050..364586 (+) 537 WP_006995346.1 phage tail protein I -
  EL190_RS01915 (NCTC8134_00391) - 364595..366841 (+) 2247 WP_006995345.1 phage tail protein -
  EL190_RS01920 (NCTC8134_00392) - 366853..367455 (+) 603 WP_005661624.1 hypothetical protein -
  EL190_RS01925 (NCTC8134_00393) - 367452..367952 (+) 501 WP_065246943.1 enoyl-CoA hydratase -
  EL190_RS01930 (NCTC8134_00394) - 368128..368247 (+) 120 WP_005641687.1 Com family DNA-binding transcriptional regulator -
  EL190_RS01935 (NCTC8134_00395) - 368304..369149 (+) 846 WP_006995342.1 hypothetical protein -
  EL190_RS01945 (NCTC8134_00396) - 369594..370778 (+) 1185 WP_006995341.1 phage tail sheath subtilisin-like domain-containing protein -
  EL190_RS01950 (NCTC8134_00397) - 370782..371288 (+) 507 WP_006995340.1 phage major tail tube protein -
  EL190_RS01955 (NCTC8134_00398) - 371357..371656 (+) 300 WP_005655095.1 phage tail assembly protein -
  EL190_RS01960 (NCTC8134_00399) - 371656..371802 (+) 147 WP_006995339.1 GpE family phage tail protein -
  EL190_RS10175 (NCTC8134_00400) - 371970..372131 (+) 162 WP_006995337.1 hypothetical protein -
  EL190_RS01965 (NCTC8134_00401) - 372131..372568 (+) 438 WP_006995336.1 phage tail protein -
  EL190_RS01970 (NCTC8134_00402) - 372568..373767 (+) 1200 WP_006995335.1 phage late control D family protein -
  EL190_RS01975 (NCTC8134_00403) - 373793..374032 (-) 240 WP_032826252.1 excalibur calcium-binding domain-containing protein -
  EL190_RS01980 (NCTC8134_00404) - 374043..375212 (-) 1170 WP_006995333.1 hypothetical protein -
  EL190_RS01985 (NCTC8134_00405) - 375222..375911 (-) 690 WP_006995332.1 S24 family peptidase -
  EL190_RS01990 (NCTC8134_00406) - 376030..376278 (+) 249 WP_013527354.1 helix-turn-helix domain-containing protein -
  EL190_RS01995 - 376643..376984 (+) 342 WP_032826251.1 hypothetical protein -
  EL190_RS02000 (NCTC8134_00409) - 377047..377289 (+) 243 WP_005655063.1 hypothetical protein -
  EL190_RS02005 (NCTC8134_00410) - 377380..377640 (+) 261 WP_006995329.1 hypothetical protein -
  EL190_RS02010 (NCTC8134_00411) - 377658..378038 (+) 381 WP_006995328.1 hypothetical protein -
  EL190_RS02015 (NCTC8134_00412) - 378042..378284 (+) 243 WP_005668404.1 hypothetical protein -
  EL190_RS02020 (NCTC8134_00414) - 378410..378718 (+) 309 WP_005655052.1 hypothetical protein -
  EL190_RS02025 (NCTC8134_00415) - 378728..380914 (+) 2187 WP_006995326.1 replication endonuclease -
  EL190_RS02030 (NCTC8134_00416) - 380933..381124 (+) 192 WP_005668397.1 hypothetical protein -
  EL190_RS02035 (NCTC8134_00417) - 381135..381344 (+) 210 WP_005668395.1 hypothetical protein -
  EL190_RS02040 (NCTC8134_00418) - 381358..381879 (+) 522 WP_005668393.1 MazG-like family protein -
  EL190_RS02050 (NCTC8134_00419) - 382118..383173 (+) 1056 WP_032826250.1 tyrosine-type recombinase/integrase -
  EL190_RS02095 sxy/tfoX 389473..390126 (-) 654 WP_006995324.1 DNA transformation protein TfoX Regulator
  EL190_RS02100 (NCTC8134_00429) recA 390499..391563 (+) 1065 WP_005654959.1 recombinase RecA Machinery gene
  EL190_RS02105 (NCTC8134_00430) recX 391643..392101 (+) 459 WP_006995323.1 recombination regulator RecX -
  EL190_RS02110 (NCTC8134_00431) crcB 392098..392484 (-) 387 WP_005692779.1 fluoride efflux transporter CrcB -

Sequence


Protein


Download         Length: 217 a.a.        Molecular weight: 24987.35 Da        Isoelectric Point: 10.0171

>NTDB_id=1122713 EL190_RS02095 WP_006995324.1 389473..390126(-) (sxy/tfoX) [Haemophilus aegyptius strain NCTC8134]
MNIKDEHIDSVCSLLDQLVGNVSFKNLFTGYGLFHKEETMFAIWQNKKLYLRGEGVLAIQLTKLGCEPFTTNELNKRFVL
SQYYALSDQVLRSNRLCRKLIILSIKQILEQKLECTLRKLNRLKDLPNLTIKHERALIKVGITNVAMLREIGAENALVEL
KKSGSGATLDFYWKLVCALQNKNSQMLSQAEKERLLKKLNEVLRKNGLKGYRKLDDE

Nucleotide


Download         Length: 654 bp        

>NTDB_id=1122713 EL190_RS02095 WP_006995324.1 389473..390126(-) (sxy/tfoX) [Haemophilus aegyptius strain NCTC8134]
ATGAATATAAAGGATGAGCATATAGATAGCGTTTGCTCCTTGTTAGATCAGTTAGTAGGAAATGTTTCCTTTAAAAATCT
TTTTACTGGTTACGGTTTGTTTCACAAGGAAGAGACAATGTTTGCCATTTGGCAAAATAAAAAACTTTATTTACGCGGTG
AGGGTGTTCTCGCAATTCAATTAACTAAATTAGGTTGTGAACCTTTTACAACGAATGAATTGAATAAGCGGTTTGTGCTT
TCACAATATTATGCACTTTCTGATCAGGTTTTACGTAGTAATAGATTGTGTAGAAAATTGATTATTCTTTCTATTAAGCA
GATTCTTGAGCAGAAGCTAGAATGTACGTTAAGAAAATTGAATCGATTAAAGGATTTACCCAATTTAACGATTAAACATG
AAAGAGCTTTAATAAAAGTTGGTATTACAAATGTTGCGATGCTAAGAGAGATTGGCGCAGAAAATGCATTGGTGGAATTA
AAGAAAAGTGGCAGTGGTGCTACGCTTGATTTTTATTGGAAATTAGTATGTGCTTTGCAAAATAAAAATAGTCAGATGTT
AAGTCAAGCTGAAAAAGAGCGTTTATTGAAGAAATTAAACGAAGTTTTGAGAAAAAATGGCTTAAAAGGCTATAGAAAAT
TAGATGATGAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Haemophilus influenzae Rd KW20

99.078

100

0.991


Multiple sequence alignment