Detailed information    

insolico Bioinformatically predicted

Overview

Name   rcrR   Type   Regulator
Locus tag   EL084_RS04610 Genome accession   NZ_LR134292
Coordinates   935633..936073 (-) Length   146 a.a.
NCBI ID   WP_004232103.1    Uniprot ID   A0A1G9MYC1
Organism   Streptococcus equinus strain NCTC10389     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 921272..949263 935633..936073 within 0


Gene organization within MGE regions


Location: 921272..949263
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL084_RS04550 (NCTC10389_00962) - 921308..922564 (+) 1257 WP_126440289.1 ISL3 family transposase -
  EL084_RS04555 (NCTC10389_00963) - 922731..923903 (-) 1173 WP_126440290.1 O-antigen ligase family protein -
  EL084_RS04560 (NCTC10389_00964) - 923907..925409 (-) 1503 WP_126440291.1 polysaccharide biosynthesis C-terminal domain-containing protein -
  EL084_RS04565 (NCTC10389_00965) - 925402..926415 (-) 1014 WP_126440292.1 alpha-1,2-fucosyltransferase -
  EL084_RS04570 (NCTC10389_00966) - 926440..927168 (-) 729 WP_126440293.1 glycosyltransferase family 32 protein -
  EL084_RS04575 (NCTC10389_00967) - 927339..928007 (-) 669 WP_126440294.1 DUF1919 domain-containing protein -
  EL084_RS04580 (NCTC10389_00968) - 928086..929183 (-) 1098 WP_126440295.1 glycosyltransferase family 1 protein -
  EL084_RS04585 (NCTC10389_00969) - 929208..929816 (-) 609 Protein_881 LCP family protein -
  EL084_RS04590 - 930338..930466 (+) 129 Protein_882 LysR family transcriptional regulator -
  EL084_RS04595 (NCTC10389_00970) - 930641..931898 (+) 1258 Protein_883 ISL3 family transposase -
  EL084_RS04600 (NCTC10389_00971) rcrQ 932053..933825 (-) 1773 WP_126440296.1 ABC transporter ATP-binding protein Regulator
  EL084_RS04605 (NCTC10389_00972) rcrP 933815..935629 (-) 1815 WP_126440297.1 ABC transporter ATP-binding protein Regulator
  EL084_RS04610 (NCTC10389_00973) rcrR 935633..936073 (-) 441 WP_004232103.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  EL084_RS04615 (NCTC10389_00974) - 936221..936631 (-) 411 WP_004232105.1 peptide deformylase -
  EL084_RS04620 (NCTC10389_00975) - 936634..937137 (-) 504 WP_126440298.1 GNAT family N-acetyltransferase -
  EL084_RS04625 (NCTC10389_00976) gdhA 937289..938638 (-) 1350 WP_126440299.1 NADP-specific glutamate dehydrogenase -
  EL084_RS04630 (NCTC10389_00977) - 938868..939368 (+) 501 WP_126440300.1 DUF308 domain-containing protein -
  EL084_RS04635 queF 939404..939888 (-) 485 Protein_891 preQ(1) synthase -
  EL084_RS04640 queE 939904..940617 (-) 714 Protein_892 7-carboxy-7-deazaguanine synthase QueE -
  EL084_RS04645 (NCTC10389_00981) queD 940610..941056 (-) 447 WP_126440301.1 6-carboxytetrahydropterin synthase QueD -
  EL084_RS04650 (NCTC10389_00982) queC 941056..941709 (-) 654 WP_126440302.1 7-cyano-7-deazaguanine synthase QueC -
  EL084_RS04655 (NCTC10389_00983) - 941873..943642 (-) 1770 WP_126440303.1 ABC transporter ATP-binding protein -
  EL084_RS04660 (NCTC10389_00984) - 943645..945384 (-) 1740 WP_115255257.1 ABC transporter ATP-binding protein -
  EL084_RS04665 (NCTC10389_00985) - 945429..947297 (-) 1869 WP_126440304.1 ABC-F family ATP-binding cassette domain-containing protein -
  EL084_RS04670 (NCTC10389_00986) - 947294..948499 (-) 1206 WP_126440305.1 CCA tRNA nucleotidyltransferase -
  EL084_RS04675 (NCTC10389_00987) dapB 948496..949263 (-) 768 WP_126440306.1 4-hydroxy-tetrahydrodipicolinate reductase -

Sequence

Protein


Download         Length: 146 a.a.        Molecular weight: 17038.57 Da        Isoelectric Point: 8.5024

>NTDB_id=1120443 EL084_RS04610 WP_004232103.1 935633..936073(-) (rcrR) [Streptococcus equinus strain NCTC10389]
MRDKDPFSQLRDFVNLMENRVHELGELHDVENLAGPQGFAVLYLRDNEDKEVFIKDIERKLKISKSVTSNLIKRMEKNGF
IKVVPSEVDKRYKRVVLTELGRAKTKDIDAFHAAVHKQIFDGISREELEISGRVFDRILKNLENKE

Nucleotide


Download         Length: 441 bp        

>NTDB_id=1120443 EL084_RS04610 WP_004232103.1 935633..936073(-) (rcrR) [Streptococcus equinus strain NCTC10389]
ATGCGAGATAAAGATCCGTTTTCACAATTAAGAGACTTCGTTAATTTGATGGAAAACCGTGTGCACGAACTCGGTGAACT
TCATGATGTGGAGAACTTAGCTGGTCCGCAGGGATTTGCGGTTTTATATCTGAGAGATAATGAAGACAAAGAAGTTTTCA
TTAAAGATATTGAACGCAAGCTTAAAATTTCAAAATCAGTAACCAGCAATTTGATTAAAAGAATGGAAAAGAATGGTTTT
ATAAAAGTTGTTCCATCTGAAGTTGATAAGCGTTACAAGCGTGTAGTACTTACAGAACTTGGCCGAGCTAAGACAAAAGA
TATTGATGCTTTTCACGCTGCGGTTCACAAGCAAATTTTTGATGGCATTAGTCGTGAAGAGCTAGAAATTTCTGGTCGTG
TCTTTGATCGTATTTTGAAAAATTTAGAAAACAAGGAGTAA

Domains

Predicted by InterproScan.

MarR family (MarR_2)

(35-91)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1G9MYC1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrR Streptococcus mutans UA159

52.448

97.945

0.514

Multiple sequence alignment