Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   EL050_RS13580 Genome accession   NZ_LR134165
Coordinates   2713539..2713715 (+) Length   58 a.a.
NCBI ID   WP_023855184.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain NCTC8721     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2708539..2718715
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL050_RS13565 (NCTC8721_02786) gcvT 2709179..2710273 (-) 1095 WP_025811165.1 glycine cleavage system aminomethyltransferase GcvT -
  EL050_RS13570 (NCTC8721_02788) - 2710868..2712547 (+) 1680 WP_020452163.1 SNF2-related protein -
  EL050_RS13575 (NCTC8721_02789) - 2712554..2713348 (+) 795 WP_020452164.1 YqhG family protein -
  EL050_RS13580 (NCTC8721_02790) sinI 2713539..2713715 (+) 177 WP_023855184.1 anti-repressor SinI family protein Regulator
  EL050_RS13585 (NCTC8721_02791) sinR 2713749..2714084 (+) 336 WP_023855185.1 helix-turn-helix domain-containing protein Regulator
  EL050_RS13590 (NCTC8721_02792) - 2714189..2714983 (-) 795 WP_020452167.1 TasA family protein -
  EL050_RS13595 (NCTC8721_02793) - 2715056..2715640 (-) 585 WP_020452168.1 signal peptidase I -
  EL050_RS13600 (NCTC8721_02794) tapA 2715637..2716365 (-) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  EL050_RS13605 (NCTC8721_02795) - 2716643..2716963 (+) 321 WP_023855188.1 YqzG/YhdC family protein -
  EL050_RS13610 (NCTC8721_02796) - 2716993..2717175 (-) 183 WP_025811164.1 YqzE family protein -
  EL050_RS13615 (NCTC8721_02797) comGG 2717265..2717630 (-) 366 WP_025811163.1 competence type IV pilus minor pilin ComGG -
  EL050_RS13620 (NCTC8721_02798) comGF 2717642..2718124 (-) 483 WP_238550077.1 competence type IV pilus minor pilin ComGF -
  EL050_RS13625 comGE 2718039..2718386 (-) 348 WP_025811161.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6709.46 Da        Isoelectric Point: 4.5938

>NTDB_id=1118600 EL050_RS13580 WP_023855184.1 2713539..2713715(+) (sinI) [Bacillus paralicheniformis strain NCTC8721]
MNKDKNEKEELDEEWTELIKHALEQGISPEDIRIFLNLGEKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=1118600 EL050_RS13580 WP_023855184.1 2713539..2713715(+) (sinI) [Bacillus paralicheniformis strain NCTC8721]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGATATACGTATTTTTCTCAATTTGGGTGAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5


Multiple sequence alignment