Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   EQB46_RS02745 Genome accession   NZ_LR129843
Coordinates   496363..496512 (+) Length   49 a.a.
NCBI ID   WP_001808912.1    Uniprot ID   A0A4J1ZTW6
Organism   Streptococcus pneumoniae strain 180-2 isolate 180-2     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 485873..495417 496363..496512 flank 946


Gene organization within MGE regions


Location: 485873..496512
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQB46_RS02675 - 485873..486160 (-) 288 WP_000777760.1 hypothetical protein -
  EQB46_RS02680 - 486170..486580 (-) 411 WP_001278301.1 HIT family protein -
  EQB46_RS02685 pptA 486648..487379 (+) 732 WP_000889923.1 ABC transporter ATP-binding protein Regulator
  EQB46_RS02690 - 487376..488425 (+) 1050 WP_000653752.1 ABC transporter permease -
  EQB46_RS02695 - 488593..488922 (-) 330 WP_000132570.1 hypothetical protein -
  EQB46_RS02700 - 489198..489536 (+) 339 WP_000682119.1 LytTR family DNA-binding domain-containing protein -
  EQB46_RS02705 comE/blpR 489541..490278 (+) 738 WP_001219127.1 response regulator transcription factor Regulator
  EQB46_RS02710 - 490292..491632 (+) 1341 WP_001017622.1 sensor histidine kinase -
  EQB46_RS02715 blpC 491674..491829 (-) 156 WP_000358813.1 quorum-sensing system pheromone BlpC -
  EQB46_RS02720 - 491886..493247 (-) 1362 WP_001069092.1 bacteriocin secretion accessory protein -
  EQB46_RS12045 comA/nlmT 493258..493746 (-) 489 WP_307774349.1 ATP-binding cassette domain-containing protein Regulator
  EQB46_RS12050 comA/nlmT 493730..494170 (-) 441 WP_001808911.1 ATP-binding cassette domain-containing protein Regulator
  EQB46_RS12055 comA/nlmT 494160..494885 (-) 726 WP_167750760.1 ABC transporter transmembrane domain-containing protein Regulator
  EQB46_RS12060 comA/nlmT 494830..495417 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  EQB46_RS02735 blpI 495699..495896 (+) 198 WP_001093258.1 bacteriocin-like peptide BlpI -
  EQB46_RS02745 cipB 496363..496512 (+) 150 WP_001808912.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5150.86 Da        Isoelectric Point: 3.7098

>NTDB_id=1116335 EQB46_RS02745 WP_001808912.1 496363..496512(+) (cipB) [Streptococcus pneumoniae strain 180-2 isolate 180-2]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=1116335 EQB46_RS02745 WP_001808912.1 496363..496512(+) (cipB) [Streptococcus pneumoniae strain 180-2 isolate 180-2]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A4J1ZTW6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51

Multiple sequence alignment