Detailed information
Overview
| Name | cipB | Type | Regulator |
| Locus tag | EQB46_RS02745 | Genome accession | NZ_LR129843 |
| Coordinates | 496363..496512 (+) | Length | 49 a.a. |
| NCBI ID | WP_001808912.1 | Uniprot ID | A0A4J1ZTW6 |
| Organism | Streptococcus pneumoniae strain 180-2 isolate 180-2 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 485873..495417 | 496363..496512 | flank | 946 |
Gene organization within MGE regions
Location: 485873..496512
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB46_RS02675 | - | 485873..486160 (-) | 288 | WP_000777760.1 | hypothetical protein | - |
| EQB46_RS02680 | - | 486170..486580 (-) | 411 | WP_001278301.1 | HIT family protein | - |
| EQB46_RS02685 | pptA | 486648..487379 (+) | 732 | WP_000889923.1 | ABC transporter ATP-binding protein | Regulator |
| EQB46_RS02690 | - | 487376..488425 (+) | 1050 | WP_000653752.1 | ABC transporter permease | - |
| EQB46_RS02695 | - | 488593..488922 (-) | 330 | WP_000132570.1 | hypothetical protein | - |
| EQB46_RS02700 | - | 489198..489536 (+) | 339 | WP_000682119.1 | LytTR family DNA-binding domain-containing protein | - |
| EQB46_RS02705 | comE/blpR | 489541..490278 (+) | 738 | WP_001219127.1 | response regulator transcription factor | Regulator |
| EQB46_RS02710 | - | 490292..491632 (+) | 1341 | WP_001017622.1 | sensor histidine kinase | - |
| EQB46_RS02715 | blpC | 491674..491829 (-) | 156 | WP_000358813.1 | quorum-sensing system pheromone BlpC | - |
| EQB46_RS02720 | - | 491886..493247 (-) | 1362 | WP_001069092.1 | bacteriocin secretion accessory protein | - |
| EQB46_RS12045 | comA/nlmT | 493258..493746 (-) | 489 | WP_307774349.1 | ATP-binding cassette domain-containing protein | Regulator |
| EQB46_RS12050 | comA/nlmT | 493730..494170 (-) | 441 | WP_001808911.1 | ATP-binding cassette domain-containing protein | Regulator |
| EQB46_RS12055 | comA/nlmT | 494160..494885 (-) | 726 | WP_167750760.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| EQB46_RS12060 | comA/nlmT | 494830..495417 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| EQB46_RS02735 | blpI | 495699..495896 (+) | 198 | WP_001093258.1 | bacteriocin-like peptide BlpI | - |
| EQB46_RS02745 | cipB | 496363..496512 (+) | 150 | WP_001808912.1 | bacteriocin-like peptide BlpO | Regulator |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5150.86 Da Isoelectric Point: 3.7098
>NTDB_id=1116335 EQB46_RS02745 WP_001808912.1 496363..496512(+) (cipB) [Streptococcus pneumoniae strain 180-2 isolate 180-2]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=1116335 EQB46_RS02745 WP_001808912.1 496363..496512(+) (cipB) [Streptococcus pneumoniae strain 180-2 isolate 180-2]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |