Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   EQB42_RS02615 Genome accession   NZ_LR129841
Coordinates   487520..487669 (+) Length   49 a.a.
NCBI ID   WP_001813641.1    Uniprot ID   A0A6I3TPS6
Organism   Streptococcus pneumoniae strain 947 isolate 947     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 485796..486601 487520..487669 flank 919


Gene organization within MGE regions


Location: 485796..487669
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQB42_RS02595 - 485796..486601 (+) 806 Protein_480 IS5 family transposase -
  EQB42_RS02600 blpM 486803..487057 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  EQB42_RS02605 blpN 487073..487276 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  EQB42_RS02615 cipB 487520..487669 (+) 150 WP_001813641.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5164.93 Da        Isoelectric Point: 3.9133

>NTDB_id=1116259 EQB42_RS02615 WP_001813641.1 487520..487669(+) (cipB) [Streptococcus pneumoniae strain 947 isolate 947]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=1116259 EQB42_RS02615 WP_001813641.1 487520..487669(+) (cipB) [Streptococcus pneumoniae strain 947 isolate 947]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I3TPS6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

48.98

100

0.49

Multiple sequence alignment