Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   EQB41_RS02890 Genome accession   NZ_LR129840
Coordinates   518366..518515 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain 4496 isolate 4496     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 516695..517499 518366..518515 flank 867


Gene organization within MGE regions


Location: 516695..518515
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQB41_RS02870 - 516695..517499 (+) 805 WP_127820735.1 IS5 family transposase -
  EQB41_RS02875 blpM 517649..517903 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  EQB41_RS02880 blpN 517919..518122 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  EQB41_RS02890 cipB 518366..518515 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=1116182 EQB41_RS02890 WP_001818346.1 518366..518515(+) (cipB) [Streptococcus pneumoniae strain 4496 isolate 4496]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=1116182 EQB41_RS02890 WP_001818346.1 518366..518515(+) (cipB) [Streptococcus pneumoniae strain 4496 isolate 4496]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51

Multiple sequence alignment