Detailed information NTG1115830

Bioinformatically predicted

Overview

• Name: comGE
• Type: Machinery gene
• Locus tag: E0E15_RS08240
• Genome accession: NZ_LR027870
• Coordinates: 1631794..1632093 (-)
• Length: 99 a.a.
• NCBI ID: WP_000844413.1
• Uniprot ID: X5E258
• Organism: Staphylococcus aureus strain BPH2019 isolate BPH2019
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	1632984..1634156	1631794..1632093	flank	891

Gene organization within MGE regions

Location: 1631794..1634156

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
E0E15_RS08240	comGE	1631794..1632093 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
E0E15_RS08245	comGD	1632080..1632526 (-)	447	WP_001790850.1	competence type IV pilus minor pilin ComGD	Machinery gene
E0E15_RS08250	comGC	1632504..1632815 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
E0E15_RS08260	-	1632984..1634156 (+)	1173	WP_000195429.1	IS256-like element IS256 family transposase	-

Sequence

Protein

• Length: 99 a.a.
• Molecular weight: 11093.20 Da
• Isoelectric Point: 9.9215

>NTDB_id=1115830 E0E15_RS08240 WP_000844413.1 1631794..1632093(-) (comGE) [Staphylococcus aureus strain BPH2019 isolate BPH2019]
MKSYKCKGSFLIDSMAGFLLIGLITLLLIPMMNQMQASINHKLQTIDASKVILTTVSKINKEELKKGVTIGKYDIKQSDQ
QICAISKNTTSYQKTCIQY

Nucleotide

• Length: 300 bp

>NTDB_id=1115830 E0E15_RS08240 WP_000844413.1 1631794..1632093(-) (comGE) [Staphylococcus aureus strain BPH2019 isolate BPH2019]
ATGAAAAGCTATAAGTGTAAAGGTTCATTCTTAATAGATAGTATGGCTGGATTTTTGCTAATTGGATTGATTACATTACT
ATTGATACCAATGATGAATCAAATGCAAGCGAGTATAAACCATAAACTACAAACAATTGATGCTTCTAAAGTAATTTTGA
CGACTGTATCTAAAATTAATAAAGAAGAACTTAAGAAGGGGGTAACTATAGGGAAGTATGATATTAAGCAAAGTGACCAA
CAAATTTGTGCTATTTCAAAAAATACCACTTCTTATCAAAAGACATGTATACAGTATTAA

Domains

No domain identified.

3D structure

• AlphaFold DB: X5E258

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGE	Staphylococcus aureus MW2	86.842	100	1
comGE	Staphylococcus aureus N315	98.99	100	0.99