Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BAMMD1_RS13910 Genome accession   NZ_LN999829
Coordinates   2948639..2948779 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain B25     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2943639..2953779
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMMD1_RS13885 (BAMMD1_2789) - 2943936..2944319 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  BAMMD1_RS13890 (BAMMD1_2790) comA 2944341..2944985 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  BAMMD1_RS13895 (BAMMD1_2791) comP 2945066..2947369 (-) 2304 WP_060387125.1 histidine kinase Regulator
  BAMMD1_RS13905 (BAMMD1_2793) comQ 2947522..2948454 (-) 933 WP_025650217.1 class 1 isoprenoid biosynthesis enzyme Regulator
  BAMMD1_RS13910 (BAMMD1_2794) degQ 2948639..2948779 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BAMMD1_RS13915 (BAMMD1_2795) - 2949245..2949586 (+) 342 WP_014305721.1 hypothetical protein -
  BAMMD1_RS13920 (BAMMD1_2796) - 2949593..2950813 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  BAMMD1_RS13925 (BAMMD1_2797) - 2950943..2952409 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  BAMMD1_RS13930 (BAMMD1_2798) - 2952427..2952978 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  BAMMD1_RS13935 (BAMMD1_2799) - 2953075..2953473 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1115447 BAMMD1_RS13910 WP_003152043.1 2948639..2948779(-) (degQ) [Bacillus velezensis strain B25]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1115447 BAMMD1_RS13910 WP_003152043.1 2948639..2948779(-) (degQ) [Bacillus velezensis strain B25]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment