Detailed information    

insolico Bioinformatically predicted

Overview

Name   HI0659   Type   Machinery gene
Locus tag   A66_RS02660 Genome accession   NZ_LN847353
Coordinates   504457..504723 (+) Length   88 a.a.
NCBI ID   WP_001808618.1    Uniprot ID   A0A0E9GZQ4
Organism   Streptococcus pneumoniae strain A66     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 489413..504723 504457..504723 within 0
IScluster/Tn 499006..504153 504457..504723 flank 304


Gene organization within MGE regions


Location: 489413..504723
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A66_RS02590 (A66_00517) licT 489413..490252 (+) 840 WP_000584530.1 BglG family transcription antiterminator LicT -
  A66_RS02595 (A66_00518) - 490270..492108 (+) 1839 WP_053039487.1 beta-glucoside-specific PTS transporter subunit IIABC -
  A66_RS02600 (A66_00519) - 492121..493536 (+) 1416 WP_053039488.1 glycoside hydrolase family 1 protein -
  A66_RS02605 (A66_00520) pheS 494018..495064 (+) 1047 WP_001818763.1 phenylalanine--tRNA ligase subunit alpha -
  A66_RS02610 (A66_00521) - 495064..495573 (+) 510 WP_053039489.1 GNAT family N-acetyltransferase -
  A66_RS02615 (A66_00522) pheT 495650..498055 (+) 2406 WP_053039490.1 phenylalanine--tRNA ligase subunit beta -
  A66_RS10765 - 498341..499698 (+) 1358 Protein_517 IS1380-like element ISSpn5 family transposase -
  A66_RS02630 (A66_00525) - 500066..501070 (-) 1005 WP_000491761.1 endonuclease/exonuclease/phosphatase family protein -
  A66_RS02635 (A66_00526) - 501091..501774 (-) 684 WP_000743644.1 DUF6973 domain-containing protein -
  A66_RS02640 - 502046..502555 (-) 510 WP_001066469.1 hypothetical protein -
  A66_RS02645 (A66_00527) - 502793..503674 (+) 882 WP_053039493.1 helix-turn-helix transcriptional regulator -
  A66_RS10770 - 503929..504332 (+) 404 Protein_522 helix-turn-helix domain-containing protein -
  A66_RS02660 (A66_00530) HI0659 504457..504723 (+) 267 WP_001808618.1 helix-turn-helix domain-containing protein Machinery gene

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9622.15 Da        Isoelectric Point: 4.4893

>NTDB_id=1114559 A66_RS02660 WP_001808618.1 504457..504723(+) (HI0659) [Streptococcus pneumoniae strain A66]
MEGCPSELFSKEEILESDMRVAIMSELIEARYEQGISQKKLEEVSGISQPVIARMETGKTSPQLDTVLKVLASLGKTLAI
VPLEQGKS

Nucleotide


Download         Length: 267 bp        

>NTDB_id=1114559 A66_RS02660 WP_001808618.1 504457..504723(+) (HI0659) [Streptococcus pneumoniae strain A66]
TTGGAAGGATGTCCATCTGAGCTCTTTAGCAAGGAGGAAATCCTTGAAAGTGATATGCGAGTGGCTATCATGAGCGAGTT
GATTGAGGCTAGGTATGAACAAGGAATCAGTCAGAAAAAGCTGGAAGAAGTCAGTGGAATAAGCCAGCCTGTCATAGCTA
GGATGGAGACAGGAAAGACTAGTCCTCAGTTGGATACAGTCTTAAAAGTCCTAGCCAGTTTAGGAAAGACACTAGCAATC
GTCCCACTTGAACAGGGAAAAAGTTGA

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(29-79)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A0E9GZQ4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  HI0659 Haemophilus influenzae Rd KW20

61.039

87.5

0.534

Multiple sequence alignment