Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   MWH27_RS16325 Genome accession   NZ_JALJVV010000001
Coordinates   3033562..3033702 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain A-5     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3028562..3038702
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MWH27_RS16300 (MWH27_16265) yuxO 3028839..3029219 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  MWH27_RS16305 (MWH27_16270) comA 3029238..3029882 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MWH27_RS16310 (MWH27_16275) comP 3029963..3032275 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  MWH27_RS16315 (MWH27_16280) comX 3032291..3032512 (-) 222 WP_014480704.1 competence pheromone ComX -
  MWH27_RS16320 (MWH27_16285) - 3032514..3033377 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  MWH27_RS16325 (MWH27_16290) degQ 3033562..3033702 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MWH27_RS16330 (MWH27_16295) - 3033924..3034049 (+) 126 WP_003228793.1 hypothetical protein -
  MWH27_RS16335 (MWH27_16300) - 3034163..3034531 (+) 369 WP_014477834.1 hypothetical protein -
  MWH27_RS16340 (MWH27_16305) pdeH 3034507..3035736 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  MWH27_RS16345 (MWH27_16310) pncB 3035872..3037344 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  MWH27_RS16350 (MWH27_16315) pncA 3037360..3037911 (-) 552 WP_014480709.1 cysteine hydrolase family protein -
  MWH27_RS16355 (MWH27_16320) yueI 3038008..3038406 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1113039 MWH27_RS16325 WP_003220708.1 3033562..3033702(-) (degQ) [Bacillus subtilis strain A-5]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1113039 MWH27_RS16325 WP_003220708.1 3033562..3033702(-) (degQ) [Bacillus subtilis strain A-5]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment