Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | MWH27_RS13345 | Genome accession | NZ_JALJVV010000001 |
| Coordinates | 2468656..2469066 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain A-5 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2464023..2498811 | 2468656..2469066 | within | 0 |
Gene organization within MGE regions
Location: 2464023..2498811
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MWH27_RS13320 (MWH27_13295) | yqeF | 2464190..2464921 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| MWH27_RS13325 (MWH27_13300) | cwlH | 2465173..2465925 (-) | 753 | WP_014480318.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| MWH27_RS13330 (MWH27_13305) | yqeD | 2466112..2466738 (+) | 627 | WP_014480319.1 | TVP38/TMEM64 family protein | - |
| MWH27_RS13335 (MWH27_13310) | gnd | 2466757..2467650 (-) | 894 | WP_014480320.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| MWH27_RS13340 (MWH27_13315) | yqeB | 2467901..2468623 (+) | 723 | WP_014480321.1 | hypothetical protein | - |
| MWH27_RS13345 (MWH27_13320) | nucA/comI | 2468656..2469066 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| MWH27_RS13350 (MWH27_13325) | sigK | 2469262..2469990 (+) | 729 | WP_013308023.1 | RNA polymerase sporulation sigma factor SigK | - |
| MWH27_RS13355 (MWH27_13330) | - | 2469990..2470088 (+) | 99 | WP_031600702.1 | hypothetical protein | - |
| MWH27_RS13360 (MWH27_13335) | - | 2470085..2470297 (-) | 213 | Protein_2580 | recombinase family protein | - |
| MWH27_RS13365 (MWH27_13340) | fumC | 2470516..2471904 (-) | 1389 | WP_014480325.1 | class II fumarate hydratase | - |
| MWH27_RS13370 (MWH27_13345) | - | 2472071..2472961 (+) | 891 | WP_014480326.1 | LysR family transcriptional regulator | - |
| MWH27_RS13375 (MWH27_13350) | - | 2473903..2474298 (+) | 396 | WP_014480327.1 | VOC family protein | - |
| MWH27_RS13385 (MWH27_13360) | - | 2475038..2476165 (-) | 1128 | WP_014480328.1 | Rap family tetratricopeptide repeat protein | - |
| MWH27_RS22515 | - | 2476347..2478273 (+) | 1927 | Protein_2585 | ribonuclease YeeF family protein | - |
| MWH27_RS13400 (MWH27_13375) | - | 2478287..2478574 (+) | 288 | WP_014480331.1 | hypothetical protein | - |
| MWH27_RS13405 (MWH27_13380) | - | 2478977..2479417 (+) | 441 | WP_014480332.1 | SMI1/KNR4 family protein | - |
| MWH27_RS13410 (MWH27_13385) | - | 2479516..2479968 (+) | 453 | WP_014480333.1 | SMI1/KNR4 family protein | - |
| MWH27_RS13415 (MWH27_13390) | cdiI | 2480065..2480424 (+) | 360 | WP_014480334.1 | ribonuclease toxin immunity protein CdiI | - |
| MWH27_RS13420 (MWH27_13395) | - | 2480529..2481008 (+) | 480 | WP_224588637.1 | hypothetical protein | - |
| MWH27_RS13425 (MWH27_13400) | - | 2481316..2481519 (-) | 204 | WP_123772462.1 | hypothetical protein | - |
| MWH27_RS13430 (MWH27_13405) | - | 2481608..2481841 (+) | 234 | WP_224588641.1 | hypothetical protein | - |
| MWH27_RS13435 (MWH27_13410) | atxG | 2482109..2482686 (+) | 578 | Protein_2593 | suppressor of fused domain protein | - |
| MWH27_RS13440 (MWH27_13415) | - | 2482796..2483086 (+) | 291 | WP_014480337.1 | contact-dependent growth inhibition system immunity protein | - |
| MWH27_RS13445 (MWH27_13420) | istA | 2483927..2485474 (+) | 1548 | WP_014480339.1 | IS21 family transposase | - |
| MWH27_RS13450 (MWH27_13425) | istB | 2485471..2486229 (+) | 759 | WP_014479891.1 | IS21-like element helper ATPase IstB | - |
| MWH27_RS13455 (MWH27_13430) | - | 2486547..2486644 (-) | 98 | Protein_2597 | N-acetylmuramoyl-L-alanine amidase | - |
| MWH27_RS13460 (MWH27_13435) | - | 2486822..2486908 (+) | 87 | WP_072592549.1 | putative holin-like toxin | - |
| MWH27_RS22550 | - | 2487195..2487631 (-) | 437 | Protein_2599 | phage tail tube protein | - |
| MWH27_RS13475 (MWH27_13450) | terS | 2487629..2488194 (-) | 566 | Protein_2600 | phage terminase small subunit | - |
| MWH27_RS13480 (MWH27_13455) | - | 2488321..2488626 (+) | 306 | WP_123772463.1 | hypothetical protein | - |
| MWH27_RS13485 (MWH27_13460) | - | 2488799..2488864 (-) | 66 | Protein_2602 | hypothetical protein | - |
| MWH27_RS13490 (MWH27_13465) | - | 2489019..2489498 (-) | 480 | WP_014480344.1 | hypothetical protein | - |
| MWH27_RS13495 (MWH27_13470) | - | 2490115..2490381 (+) | 267 | WP_033881358.1 | hypothetical protein | - |
| MWH27_RS13500 (MWH27_13475) | - | 2490520..2490672 (-) | 153 | WP_049832653.1 | XtrA/YqaO family protein | - |
| MWH27_RS13505 (MWH27_13480) | - | 2490755..2490877 (-) | 123 | Protein_2606 | RusA family crossover junction endodeoxyribonuclease | - |
| MWH27_RS13510 (MWH27_13485) | - | 2490840..2491088 (-) | 249 | Protein_2607 | hypothetical protein | - |
| MWH27_RS13515 (MWH27_13490) | - | 2491233..2491463 (-) | 231 | WP_224588644.1 | hypothetical protein | - |
| MWH27_RS13520 (MWH27_13495) | - | 2491772..2491952 (-) | 181 | Protein_2609 | hypothetical protein | - |
| MWH27_RS13525 (MWH27_13500) | bltR | 2492160..2492981 (-) | 822 | WP_014480349.1 | multidrug efflux transcriptional regulator BltR | - |
| MWH27_RS13530 (MWH27_13505) | blt | 2493098..2494300 (+) | 1203 | WP_014480350.1 | multidrug efflux MFS transporter Blt | - |
| MWH27_RS13535 (MWH27_13510) | bltD | 2494482..2494940 (+) | 459 | WP_014480351.1 | spermine/spermidine acetyltransferase | - |
| MWH27_RS13540 (MWH27_13515) | yrkA | 2495099..2496403 (-) | 1305 | WP_014480352.1 | hemolysin family protein | - |
| MWH27_RS13545 (MWH27_13520) | yrzO | 2496693..2496836 (-) | 144 | WP_014477437.1 | YrzO family protein | - |
| MWH27_RS13550 (MWH27_13525) | yrdR | 2496854..2497819 (-) | 966 | WP_014480354.1 | DMT family transporter | - |
| MWH27_RS13555 (MWH27_13530) | czcR | 2497945..2498811 (+) | 867 | WP_014480355.1 | LysR family transcriptional regulator CzcR | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=1113028 MWH27_RS13345 WP_009967785.1 2468656..2469066(-) (nucA/comI) [Bacillus subtilis strain A-5]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=1113028 MWH27_RS13345 WP_009967785.1 2468656..2469066(-) (nucA/comI) [Bacillus subtilis strain A-5]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |