Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   ACOGJJ_RS11665 Genome accession   NZ_CP184769
Coordinates   2294728..2295006 (+) Length   92 a.a.
NCBI ID   WP_199630334.1    Uniprot ID   -
Organism   Bacillus cereus strain JG8     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2284666..2326481 2294728..2295006 within 0


Gene organization within MGE regions


Location: 2284666..2326481
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACOGJJ_RS11590 (ACOGJJ_11590) - 2284666..2284929 (+) 264 WP_002082716.1 DUF3937 domain-containing protein -
  ACOGJJ_RS11595 (ACOGJJ_11595) - 2285488..2285823 (+) 336 WP_058839790.1 heterocycloanthracin/sonorensin family bacteriocin -
  ACOGJJ_RS11600 (ACOGJJ_11600) - 2285969..2286103 (+) 135 Protein_2251 site-specific integrase -
  ACOGJJ_RS11605 (ACOGJJ_11605) - 2286313..2286798 (+) 486 WP_002182774.1 hypothetical protein -
  ACOGJJ_RS11610 (ACOGJJ_11610) - 2287110..2287811 (+) 702 WP_420729249.1 pPIWI_RE module domain-containing protein -
  ACOGJJ_RS11615 (ACOGJJ_11615) - 2287850..2288959 (-) 1110 WP_199630339.1 tyrosine-type recombinase/integrase -
  ACOGJJ_RS11620 (ACOGJJ_11620) - 2289263..2290162 (+) 900 WP_221660009.1 exosporium leader peptide-containing protein -
  ACOGJJ_RS11625 (ACOGJJ_11625) - 2290719..2291897 (+) 1179 WP_199630337.1 AimR family lysis-lysogeny pheromone receptor -
  ACOGJJ_RS11630 (ACOGJJ_11630) - 2291894..2292037 (+) 144 WP_199630368.1 hypothetical protein -
  ACOGJJ_RS11635 (ACOGJJ_11635) - 2292206..2292334 (+) 129 WP_254914829.1 hypothetical protein -
  ACOGJJ_RS11640 (ACOGJJ_11640) - 2292350..2292718 (-) 369 WP_086403815.1 helix-turn-helix domain-containing protein -
  ACOGJJ_RS11645 (ACOGJJ_11645) - 2292936..2293157 (+) 222 WP_199630336.1 helix-turn-helix transcriptional regulator -
  ACOGJJ_RS11650 (ACOGJJ_11650) - 2293214..2293480 (+) 267 WP_086403813.1 helix-turn-helix domain-containing protein -
  ACOGJJ_RS11655 (ACOGJJ_11655) - 2293480..2293644 (+) 165 WP_086403812.1 hypothetical protein -
  ACOGJJ_RS11660 (ACOGJJ_11660) - 2293702..2294724 (+) 1023 WP_199630335.1 DnaD domain-containing protein -
  ACOGJJ_RS11665 (ACOGJJ_11665) abrB 2294728..2295006 (+) 279 WP_199630334.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  ACOGJJ_RS11670 (ACOGJJ_11670) - 2294999..2295358 (+) 360 WP_199630333.1 cell division protein SepF -
  ACOGJJ_RS11675 (ACOGJJ_11675) - 2295378..2295545 (+) 168 WP_080470708.1 DUF3954 domain-containing protein -
  ACOGJJ_RS11680 (ACOGJJ_11680) - 2295571..2295822 (+) 252 WP_199630332.1 helix-turn-helix domain containing protein -
  ACOGJJ_RS11685 (ACOGJJ_11685) - 2295842..2296297 (+) 456 WP_199630331.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  ACOGJJ_RS11690 (ACOGJJ_11690) - 2296510..2297238 (-) 729 WP_206773632.1 glycosyltransferase family 2 protein -
  ACOGJJ_RS11695 (ACOGJJ_11695) - 2297514..2298302 (-) 789 WP_199630330.1 sulfotransferase family 2 domain-containing protein -
  ACOGJJ_RS11700 (ACOGJJ_11700) - 2299172..2299375 (+) 204 WP_098400107.1 DUF7681 family protein -
  ACOGJJ_RS11705 (ACOGJJ_11705) - 2299416..2299700 (+) 285 WP_176374207.1 hypothetical protein -
  ACOGJJ_RS11710 (ACOGJJ_11710) - 2301217..2301459 (+) 243 WP_106919021.1 hypothetical protein -
  ACOGJJ_RS11715 (ACOGJJ_11715) - 2301493..2301843 (+) 351 WP_098584691.1 hypothetical protein -
  ACOGJJ_RS11720 (ACOGJJ_11720) - 2301854..2301976 (+) 123 WP_098584692.1 DUF3983 domain-containing protein -
  ACOGJJ_RS11725 (ACOGJJ_11725) - 2302094..2302264 (+) 171 WP_000645539.1 hypothetical protein -
  ACOGJJ_RS11730 (ACOGJJ_11730) - 2302292..2302774 (+) 483 WP_098584693.1 ArpU family phage packaging/lysis transcriptional regulator -
  ACOGJJ_RS11735 (ACOGJJ_11735) - 2302774..2303316 (+) 543 WP_098584694.1 site-specific integrase -
  ACOGJJ_RS11740 (ACOGJJ_11740) - 2303526..2304161 (+) 636 WP_172605286.1 hypothetical protein -
  ACOGJJ_RS11745 (ACOGJJ_11745) - 2304585..2305466 (+) 882 WP_199630329.1 hypothetical protein -
  ACOGJJ_RS11750 (ACOGJJ_11750) - 2305703..2305957 (+) 255 WP_144469459.1 hypothetical protein -
  ACOGJJ_RS11755 (ACOGJJ_11755) - 2305947..2306324 (+) 378 WP_144469461.1 HNH endonuclease -
  ACOGJJ_RS11760 (ACOGJJ_11760) - 2306453..2306956 (+) 504 WP_000251640.1 phage terminase small subunit P27 family -
  ACOGJJ_RS11765 (ACOGJJ_11765) - 2306958..2308652 (+) 1695 WP_163093412.1 terminase large subunit -
  ACOGJJ_RS11770 (ACOGJJ_11770) - 2308841..2310094 (+) 1254 WP_163093411.1 phage portal protein -
  ACOGJJ_RS11775 (ACOGJJ_11775) - 2310081..2310791 (+) 711 WP_146719439.1 head maturation protease, ClpP-related -
  ACOGJJ_RS11780 (ACOGJJ_11780) - 2310829..2312001 (+) 1173 WP_199630328.1 phage major capsid protein -
  ACOGJJ_RS11785 (ACOGJJ_11785) - 2312022..2312309 (+) 288 WP_199630327.1 head-tail connector protein -
  ACOGJJ_RS11790 (ACOGJJ_11790) - 2312296..2312619 (+) 324 WP_199630326.1 phage head closure protein -
  ACOGJJ_RS11795 (ACOGJJ_11795) - 2312612..2313049 (+) 438 WP_199630325.1 HK97-gp10 family putative phage morphogenesis protein -
  ACOGJJ_RS11800 (ACOGJJ_11800) gp17 2313046..2313405 (+) 360 WP_100618367.1 tail completion protein gp17 -
  ACOGJJ_RS11805 (ACOGJJ_11805) - 2313406..2314011 (+) 606 WP_098208576.1 major tail protein -
  ACOGJJ_RS11810 (ACOGJJ_11810) gpG 2314059..2314376 (+) 318 WP_144469481.1 phage tail assembly chaperone G -
  ACOGJJ_RS11815 (ACOGJJ_11815) - 2314406..2314582 (+) 177 WP_153588223.1 hypothetical protein -
  ACOGJJ_RS11820 (ACOGJJ_11820) - 2314597..2318445 (+) 3849 WP_199630324.1 phage tail tape measure protein -
  ACOGJJ_RS11825 (ACOGJJ_11825) - 2318460..2319932 (+) 1473 WP_199630323.1 distal tail protein Dit -
  ACOGJJ_RS11830 (ACOGJJ_11830) - 2319929..2324458 (+) 4530 WP_420729250.1 phage tail spike protein -
  ACOGJJ_RS11835 (ACOGJJ_11835) - 2324474..2324851 (+) 378 WP_086401927.1 hypothetical protein -
  ACOGJJ_RS11840 (ACOGJJ_11840) - 2324945..2325181 (+) 237 WP_000398738.1 hemolysin XhlA family protein -
  ACOGJJ_RS11845 (ACOGJJ_11845) - 2325181..2325420 (+) 240 WP_146719110.1 holin -
  ACOGJJ_RS11850 (ACOGJJ_11850) - 2325417..2326481 (+) 1065 WP_199630321.1 N-acetylmuramoyl-L-alanine amidase -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10041.56 Da        Isoelectric Point: 5.1584

>NTDB_id=1111181 ACOGJJ_RS11665 WP_199630334.1 2294728..2295006(+) (abrB) [Bacillus cereus strain JG8]
MKNTGVARKVDELGRVVIPVELRKTLGIAEGTALDFHVDGENIVLRKHEKSCFVTGEVFETNIELLGGRIFLSKEGASEL
LDFIQKSGLADA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=1111181 ACOGJJ_RS11665 WP_199630334.1 2294728..2295006(+) (abrB) [Bacillus cereus strain JG8]
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAAAACTTTAGG
GATTGCCGAAGGAACGGCACTAGATTTTCATGTCGATGGTGAAAACATTGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTTTGAAACCAACATAGAGTTGCTAGGTGGCCGAATATTTTTAAGCAAGGAAGGGGCAAGTGAATTA
CTGGATTTTATTCAGAAGAGTGGGCTGGCAGATGCCTAA

Domains

Predicted by InterproScan.

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-49)

AbrB C-terminal domain (AbrB_C)

(52-86)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

58.621

94.565

0.554

Multiple sequence alignment