Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | ACNBEW_RS14750 | Genome accession | NZ_CP184280 |
| Coordinates | 2998166..2998306 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain GHZJ | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2993166..3003306
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACNBEW_RS14725 (ACNBEW_14725) | - | 2993512..2993895 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| ACNBEW_RS14730 (ACNBEW_14730) | comA | 2993917..2994561 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| ACNBEW_RS14735 (ACNBEW_14735) | comP | 2994642..2996942 (-) | 2301 | WP_032876801.1 | histidine kinase | Regulator |
| ACNBEW_RS14740 (ACNBEW_14740) | comX | 2996956..2997129 (-) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| ACNBEW_RS14745 (ACNBEW_14745) | - | 2997098..2997958 (-) | 861 | WP_142925231.1 | polyprenyl synthetase family protein | - |
| ACNBEW_RS14750 (ACNBEW_14750) | degQ | 2998166..2998306 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| ACNBEW_RS14755 (ACNBEW_14755) | - | 2998772..2999113 (+) | 342 | WP_032876795.1 | hypothetical protein | - |
| ACNBEW_RS14760 (ACNBEW_14760) | - | 2999120..3000343 (-) | 1224 | WP_032876792.1 | EAL and HDOD domain-containing protein | - |
| ACNBEW_RS14765 (ACNBEW_14765) | - | 3000473..3001939 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| ACNBEW_RS14770 (ACNBEW_14770) | - | 3001957..3002508 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| ACNBEW_RS14775 (ACNBEW_14775) | - | 3002605..3003003 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=1108200 ACNBEW_RS14750 WP_003152043.1 2998166..2998306(-) (degQ) [Bacillus velezensis strain GHZJ]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=1108200 ACNBEW_RS14750 WP_003152043.1 2998166..2998306(-) (degQ) [Bacillus velezensis strain GHZJ]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |