Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   ACNBEW_RS11700 Genome accession   NZ_CP184280
Coordinates   2440118..2440555 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain GHZJ     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2435118..2445555
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACNBEW_RS11650 (ACNBEW_11650) sinI 2435501..2435674 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  ACNBEW_RS11655 (ACNBEW_11655) sinR 2435708..2436043 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACNBEW_RS11660 (ACNBEW_11660) tasA 2436091..2436876 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  ACNBEW_RS11665 (ACNBEW_11665) sipW 2436941..2437525 (-) 585 WP_032874025.1 signal peptidase I SipW -
  ACNBEW_RS11670 (ACNBEW_11670) tapA 2437497..2438168 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  ACNBEW_RS11675 (ACNBEW_11675) - 2438427..2438756 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  ACNBEW_RS11680 (ACNBEW_11680) - 2438797..2438976 (-) 180 WP_022552966.1 YqzE family protein -
  ACNBEW_RS11685 (ACNBEW_11685) comGG 2439033..2439410 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACNBEW_RS11690 (ACNBEW_11690) comGF 2439411..2439911 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  ACNBEW_RS11695 (ACNBEW_11695) comGE 2439820..2440134 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACNBEW_RS11700 (ACNBEW_11700) comGD 2440118..2440555 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACNBEW_RS11705 (ACNBEW_11705) comGC 2440545..2440853 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACNBEW_RS11710 (ACNBEW_11710) comGB 2440858..2441895 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACNBEW_RS11715 (ACNBEW_11715) comGA 2441882..2442952 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACNBEW_RS11720 (ACNBEW_11720) - 2443149..2444099 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -
  ACNBEW_RS11725 (ACNBEW_11725) - 2444245..2445546 (+) 1302 WP_032874010.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=1108182 ACNBEW_RS11700 WP_007612572.1 2440118..2440555(-) (comGD) [Bacillus velezensis strain GHZJ]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=1108182 ACNBEW_RS11700 WP_007612572.1 2440118..2440555(-) (comGD) [Bacillus velezensis strain GHZJ]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCATATTACACTTGTAACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559


Multiple sequence alignment