Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   ACN2AT_RS16370 Genome accession   NZ_CP183238
Coordinates   3144824..3144991 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain NDmed     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3139824..3149991
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACN2AT_RS16340 (ACN2AT_16235) mrpE 3140219..3140695 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  ACN2AT_RS16345 (ACN2AT_16240) mrpF 3140695..3140979 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  ACN2AT_RS16350 (ACN2AT_16245) mnhG 3140963..3141337 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  ACN2AT_RS16355 (ACN2AT_16250) yuxO 3141376..3141756 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  ACN2AT_RS16360 (ACN2AT_16255) comA 3141775..3142419 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACN2AT_RS16365 (ACN2AT_16260) comP 3142500..3144809 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  ACN2AT_RS16370 (ACN2AT_16265) comX 3144824..3144991 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  ACN2AT_RS16375 (ACN2AT_16270) comQ 3144979..3145878 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  ACN2AT_RS16380 (ACN2AT_16275) degQ 3146063..3146203 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACN2AT_RS16385 (ACN2AT_16280) - 3146425..3146550 (+) 126 WP_003228793.1 hypothetical protein -
  ACN2AT_RS16390 (ACN2AT_16285) - 3146664..3147032 (+) 369 WP_003243784.1 hypothetical protein -
  ACN2AT_RS16395 (ACN2AT_16290) pdeH 3147008..3148237 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ACN2AT_RS16400 (ACN2AT_16295) pncB 3148374..3149846 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=1104702 ACN2AT_RS16370 WP_003242801.1 3144824..3144991(-) (comX) [Bacillus subtilis strain NDmed]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=1104702 ACN2AT_RS16370 WP_003242801.1 3144824..3144991(-) (comX) [Bacillus subtilis strain NDmed]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment