Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACNM63_RS15255 Genome accession   NZ_CP183191
Coordinates   3087573..3087713 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain QC02     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3082573..3092713
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACNM63_RS15230 (ACNM63_15230) - 3082913..3083296 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  ACNM63_RS15235 (ACNM63_15235) comA 3083318..3083962 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  ACNM63_RS15240 (ACNM63_15240) comP 3084043..3086334 (-) 2292 WP_015387784.1 histidine kinase Regulator
  ACNM63_RS15245 (ACNM63_15245) comX 3086346..3086510 (-) 165 WP_007613432.1 competence pheromone ComX -
  ACNM63_RS15250 (ACNM63_15250) - 3086510..3087421 (-) 912 WP_128497091.1 polyprenyl synthetase family protein -
  ACNM63_RS15255 (ACNM63_15255) degQ 3087573..3087713 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACNM63_RS15260 (ACNM63_15260) - 3088179..3088520 (+) 342 WP_021495366.1 hypothetical protein -
  ACNM63_RS15265 (ACNM63_15265) - 3088527..3089750 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  ACNM63_RS15270 (ACNM63_15270) - 3089880..3091346 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  ACNM63_RS15275 (ACNM63_15275) - 3091364..3091915 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACNM63_RS15280 (ACNM63_15280) - 3092012..3092410 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1104399 ACNM63_RS15255 WP_003152043.1 3087573..3087713(-) (degQ) [Bacillus velezensis strain QC02]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1104399 ACNM63_RS15255 WP_003152043.1 3087573..3087713(-) (degQ) [Bacillus velezensis strain QC02]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment