Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   ACNLFN_RS07735 Genome accession   NZ_CP182626
Coordinates   1638473..1639078 (+) Length   201 a.a.
NCBI ID   WP_001202375.1    Uniprot ID   A0A5I0N148
Organism   Salmonella enterica subsp. enterica serovar Infantis strain N24-1044-GF8     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1604872..1647338 1638473..1639078 within 0


Gene organization within MGE regions


Location: 1604872..1647338
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACNLFN_RS07605 (ACNLFN_07605) ldtD 1604912..1606759 (+) 1848 WP_000925896.1 L,D-transpeptidase -
  ACNLFN_RS07610 (ACNLFN_07610) - 1607019..1607567 (+) 549 WP_000357052.1 YcbK family protein -
  ACNLFN_RS07615 (ACNLFN_07615) - 1607595..1608242 (+) 648 WP_001109471.1 MBL fold metallo-hydrolase -
  ACNLFN_RS07620 (ACNLFN_07620) - 1608340..1609595 (+) 1256 WP_086016038.1 IS3-like element ISSen1 family transposase -
  ACNLFN_RS07625 (ACNLFN_07625) aspC 1609619..1610809 (-) 1191 WP_000462653.1 aspartate transaminase -
  ACNLFN_RS07630 (ACNLFN_07630) ompF 1610994..1612085 (-) 1092 WP_000977709.1 porin OmpF -
  ACNLFN_RS07635 (ACNLFN_07635) asnS 1612692..1614092 (-) 1401 WP_023993514.1 asparagine--tRNA ligase -
  ACNLFN_RS07640 (ACNLFN_07640) - 1614293..1614754 (-) 462 WP_000762342.1 Lrp/AsnC family transcriptional regulator -
  ACNLFN_RS07645 (ACNLFN_07645) dpaL 1615071..1616285 (+) 1215 WP_020438006.1 diaminopropionate ammonia-lyase -
  ACNLFN_RS07650 (ACNLFN_07650) - 1616531..1617964 (+) 1434 WP_000893191.1 alanine/glycine:cation symporter family protein -
  ACNLFN_RS07655 (ACNLFN_07655) pncB 1618045..1619247 (-) 1203 WP_023993513.1 nicotinate phosphoribosyltransferase -
  ACNLFN_RS07660 (ACNLFN_07660) pepN 1619514..1622126 (+) 2613 WP_023993512.1 aminopeptidase N -
  ACNLFN_RS07665 (ACNLFN_07665) pyrD 1622334..1623344 (+) 1011 WP_000291723.1 quinone-dependent dihydroorotate dehydrogenase -
  ACNLFN_RS07670 (ACNLFN_07670) zapC 1623510..1624052 (+) 543 WP_023993511.1 cell division protein ZapC -
  ACNLFN_RS07675 (ACNLFN_07675) - 1624049..1625158 (-) 1110 WP_023993510.1 YcbX family protein -
  ACNLFN_RS07680 (ACNLFN_07680) rlmKL 1625257..1627365 (+) 2109 WP_023993509.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  ACNLFN_RS07685 (ACNLFN_07685) - 1627378..1629285 (+) 1908 WP_023993508.1 ABC transporter ATP-binding protein -
  ACNLFN_RS07690 (ACNLFN_07690) pqiA 1629300..1630553 (+) 1254 WP_000333152.1 membrane integrity-associated transporter subunit PqiA -
  ACNLFN_RS07695 (ACNLFN_07695) pqiB 1630558..1632198 (+) 1641 WP_000433414.1 intermembrane transport protein PqiB -
  ACNLFN_RS07700 (ACNLFN_07700) pqiC 1632195..1632758 (+) 564 WP_000759136.1 membrane integrity-associated transporter subunit PqiC -
  ACNLFN_RS07705 (ACNLFN_07705) rmf 1633014..1633181 (+) 168 WP_001537784.1 ribosome modulation factor -
  ACNLFN_RS07710 (ACNLFN_07710) fabA 1633281..1633799 (-) 519 WP_000227928.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  ACNLFN_RS07715 (ACNLFN_07715) - 1633868..1635628 (-) 1761 WP_000156457.1 AAA family ATPase -
  ACNLFN_RS07720 (ACNLFN_07720) matP 1635814..1636266 (+) 453 WP_000877172.1 macrodomain Ter protein MatP -
  ACNLFN_RS07725 (ACNLFN_07725) ompA 1636338..1637390 (-) 1053 WP_001670727.1 porin OmpA -
  ACNLFN_RS07730 (ACNLFN_07730) sulA 1637747..1638256 (-) 510 WP_000288732.1 SOS-induced cell division inhibitor SulA -
  ACNLFN_RS07735 (ACNLFN_07735) sxy/tfoX 1638473..1639078 (+) 606 WP_001202375.1 TfoX/Sxy family DNA transformation protein Regulator
  ACNLFN_RS07740 (ACNLFN_07740) yccS 1639065..1641218 (-) 2154 WP_000950876.1 YccS family putative transporter -
  ACNLFN_RS07745 (ACNLFN_07745) - 1641237..1641683 (-) 447 WP_023993507.1 YccF domain-containing protein -
  ACNLFN_RS07750 (ACNLFN_07750) helD 1641807..1643861 (+) 2055 WP_023993506.1 DNA helicase IV -
  ACNLFN_RS07755 (ACNLFN_07755) mgsA 1643897..1644355 (-) 459 WP_023993505.1 methylglyoxal synthase -
  ACNLFN_RS07760 (ACNLFN_07760) - 1644450..1645112 (-) 663 WP_000847719.1 DUF2057 family protein -
  ACNLFN_RS07765 (ACNLFN_07765) - 1645286..1645699 (+) 414 WP_001537782.1 CoA-binding protein -
  ACNLFN_RS07770 (ACNLFN_07770) hspQ 1645744..1646061 (-) 318 WP_000561983.1 heat shock protein HspQ -
  ACNLFN_RS07775 (ACNLFN_07775) rlmI 1646119..1647330 (-) 1212 WP_000140480.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -

Sequence


Protein


Download         Length: 201 a.a.        Molecular weight: 23174.94 Da        Isoelectric Point: 8.7403

>NTDB_id=1102471 ACNLFN_RS07735 WP_001202375.1 1638473..1639078(+) (sxy/tfoX) [Salmonella enterica subsp. enterica serovar Infantis strain N24-1044-GF8]
MRALSYDRIYKSQEYLASLGTIQYRSLFGSYSLTVEDTVFAMVANGELYLRACEESVPYCVKHPPAWLMFMKCGRPVMLN
YYRVDESLWRDQQQLVRLSKYSLDAAMKEKHSRILQHRLKDLPNMTFHLETLLNESGIKDENMLRILGAKMCWLRLRQSN
PLLTVKVLYALEGAIVGVHEAALPASRRQELADWAHSLTAG

Nucleotide


Download         Length: 606 bp        

>NTDB_id=1102471 ACNLFN_RS07735 WP_001202375.1 1638473..1639078(+) (sxy/tfoX) [Salmonella enterica subsp. enterica serovar Infantis strain N24-1044-GF8]
ATGAGAGCACTCTCTTATGACAGGATCTATAAATCGCAAGAATATTTGGCCTCTTTGGGGACGATCCAGTATCGATCTTT
ATTCGGTAGCTATAGTCTGACCGTGGAGGATACCGTCTTTGCGATGGTGGCTAATGGCGAGCTTTATCTCCGCGCCTGTG
AAGAAAGCGTACCCTACTGTGTGAAGCATCCTCCCGCCTGGCTCATGTTTATGAAATGTGGACGTCCCGTTATGCTCAAC
TATTACCGGGTGGATGAAAGCCTGTGGCGCGATCAGCAGCAGCTGGTGCGTTTATCGAAGTATTCTCTTGACGCGGCAAT
GAAGGAAAAACACAGCCGTATTTTACAGCACAGACTCAAAGATCTCCCCAATATGACCTTCCATCTGGAAACATTGCTCA
ATGAGTCAGGGATAAAGGACGAAAATATGTTACGCATACTGGGCGCGAAAATGTGCTGGCTAAGGTTGCGACAAAGCAAT
CCCTTGCTGACGGTGAAAGTTTTGTATGCCCTGGAAGGCGCAATTGTCGGCGTACATGAAGCGGCGCTCCCGGCGAGTCG
TCGCCAGGAGCTTGCCGACTGGGCTCATTCGCTTACGGCTGGGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5I0N148

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

75.879

99.005

0.751


Multiple sequence alignment