Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACNVPQ_RS15350 Genome accession   NZ_CP182318
Coordinates   3102220..3102360 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain Scm3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3097220..3107360
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACNVPQ_RS15325 - 3097566..3097949 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  ACNVPQ_RS15330 comA 3097971..3098615 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACNVPQ_RS15335 comP 3098696..3100996 (-) 2301 WP_124935036.1 histidine kinase Regulator
  ACNVPQ_RS15340 comX 3101010..3101183 (-) 174 WP_012118314.1 competence pheromone ComX -
  ACNVPQ_RS15345 - 3101152..3102012 (-) 861 WP_157774448.1 polyprenyl synthetase family protein -
  ACNVPQ_RS15350 degQ 3102220..3102360 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACNVPQ_RS15355 - 3102823..3103164 (+) 342 WP_007408677.1 hypothetical protein -
  ACNVPQ_RS15360 - 3103171..3104394 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  ACNVPQ_RS15365 - 3104524..3105990 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  ACNVPQ_RS15370 - 3106008..3106559 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACNVPQ_RS15375 - 3106656..3107054 (-) 399 WP_015240486.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1101148 ACNVPQ_RS15350 WP_003152043.1 3102220..3102360(-) (degQ) [Bacillus velezensis strain Scm3]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1101148 ACNVPQ_RS15350 WP_003152043.1 3102220..3102360(-) (degQ) [Bacillus velezensis strain Scm3]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment