Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   ACNVPQ_RS08955 Genome accession   NZ_CP182318
Coordinates   1823209..1823643 (+) Length   144 a.a.
NCBI ID   WP_015417516.1    Uniprot ID   -
Organism   Bacillus velezensis strain Scm3     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1824514..1838371 1823209..1823643 flank 871
IScluster/Tn 1824514..1825664 1823209..1823643 flank 871


Gene organization within MGE regions


Location: 1823209..1838371
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACNVPQ_RS08955 nucA/comI 1823209..1823643 (+) 435 WP_015417516.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  ACNVPQ_RS08960 - 1823703..1824458 (+) 756 WP_003154084.1 YoaK family protein -
  ACNVPQ_RS08970 - 1825780..1826142 (-) 363 WP_007410383.1 hypothetical protein -
  ACNVPQ_RS08975 - 1826335..1827663 (-) 1329 WP_039063127.1 S8 family peptidase -
  ACNVPQ_RS08980 - 1827842..1828075 (+) 234 WP_015239897.1 hypothetical protein -
  ACNVPQ_RS08985 - 1828331..1829038 (+) 708 WP_007410381.1 poly-gamma-glutamate hydrolase family protein -
  ACNVPQ_RS08990 - 1829098..1829550 (+) 453 WP_007410380.1 OsmC family protein -
  ACNVPQ_RS08995 - 1829564..1829917 (-) 354 WP_007410379.1 DMT family transporter -
  ACNVPQ_RS09000 - 1829935..1830249 (-) 315 WP_007410378.1 DMT family transporter -
  ACNVPQ_RS09005 - 1830388..1830693 (-) 306 WP_015239898.1 hypothetical protein -
  ACNVPQ_RS09010 - 1830795..1831199 (+) 405 WP_032866019.1 YmaF family protein -
  ACNVPQ_RS09015 miaA 1831298..1832242 (+) 945 WP_007410375.1 tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA -
  ACNVPQ_RS09020 hfq 1832282..1832503 (+) 222 WP_003154064.1 RNA chaperone Hfq -
  ACNVPQ_RS09025 - 1832600..1832875 (+) 276 WP_007410374.1 YmzC family protein -
  ACNVPQ_RS09030 - 1832958..1833173 (+) 216 WP_003154062.1 hypothetical protein -
  ACNVPQ_RS09035 nrdI 1833433..1833825 (+) 393 WP_003154061.1 class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI -
  ACNVPQ_RS09040 nrdE 1833785..1835887 (+) 2103 WP_007611605.1 class 1b ribonucleoside-diphosphate reductase subunit alpha -
  ACNVPQ_RS09045 nrdF 1835905..1836894 (+) 990 WP_012117608.1 class 1b ribonucleoside-diphosphate reductase subunit beta -
  ACNVPQ_RS09050 - 1836943..1837563 (+) 621 WP_012117609.1 hypothetical protein -
  ACNVPQ_RS09055 - 1837613..1838371 (-) 759 WP_012117610.1 N-acetylmuramoyl-L-alanine amidase -

Sequence


Protein


Download         Length: 144 a.a.        Molecular weight: 15514.44 Da        Isoelectric Point: 7.2418

>NTDB_id=1101123 ACNVPQ_RS08955 WP_015417516.1 1823209..1823643(+) (nucA/comI) [Bacillus velezensis strain Scm3]
MNAFMKWAASLLLVISLQFGLTGAGIHSDSAARAASRYDQVLYFPLSKYPETGNHIKDAISAGHSEICTIDRGGAENRRK
ESLKGIPTKPGFDRDEWPMAVCTEGGAGADVRYVTPSDNRGAGSWVGNQMSGYSDGTRVLFIVQ

Nucleotide


Download         Length: 435 bp        

>NTDB_id=1101123 ACNVPQ_RS08955 WP_015417516.1 1823209..1823643(+) (nucA/comI) [Bacillus velezensis strain Scm3]
ATGAATGCGTTTATGAAATGGGCGGCAAGTCTGCTTTTGGTGATCTCTCTTCAGTTCGGCCTTACGGGCGCCGGTATCCA
TTCGGACAGTGCTGCTCGTGCCGCATCCCGATACGATCAGGTGCTGTATTTCCCGCTGTCAAAATATCCGGAGACGGGAA
ATCATATAAAAGACGCCATTTCGGCAGGTCATTCTGAGATTTGTACAATTGATCGGGGCGGAGCAGAGAATAGAAGGAAA
GAATCATTGAAAGGAATTCCGACAAAGCCCGGGTTTGACCGTGATGAATGGCCCATGGCAGTCTGCACAGAAGGCGGGGC
GGGGGCTGATGTCAGATATGTAACCCCGTCGGATAACCGCGGGGCCGGTTCATGGGTTGGAAATCAAATGAGCGGATATT
CCGACGGCACGAGAGTATTATTTATCGTTCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

57.258

86.111

0.493


Multiple sequence alignment