Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACM9DY_RS15875 Genome accession   NZ_CP182170
Coordinates   3168140..3168280 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain F3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3163140..3173280
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACM9DY_RS15850 (ACM9DY_15850) - 3163480..3163863 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  ACM9DY_RS15855 (ACM9DY_15855) comA 3163885..3164529 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACM9DY_RS15860 (ACM9DY_15860) comP 3164610..3166901 (-) 2292 WP_014305719.1 histidine kinase Regulator
  ACM9DY_RS15865 (ACM9DY_15865) comX 3166913..3167077 (-) 165 WP_007613432.1 competence pheromone ComX -
  ACM9DY_RS15870 (ACM9DY_15870) - 3167077..3167988 (-) 912 WP_014305720.1 polyprenyl synthetase family protein -
  ACM9DY_RS15875 (ACM9DY_15875) degQ 3168140..3168280 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACM9DY_RS15880 (ACM9DY_15880) - 3168746..3169087 (+) 342 WP_014305721.1 hypothetical protein -
  ACM9DY_RS15885 (ACM9DY_15885) - 3169094..3170314 (-) 1221 WP_230639624.1 EAL and HDOD domain-containing protein -
  ACM9DY_RS15890 (ACM9DY_15890) - 3170444..3171910 (-) 1467 WP_416515782.1 nicotinate phosphoribosyltransferase -
  ACM9DY_RS15895 (ACM9DY_15895) - 3171928..3172479 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACM9DY_RS15900 (ACM9DY_15900) - 3172576..3172974 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1100718 ACM9DY_RS15875 WP_003152043.1 3168140..3168280(-) (degQ) [Bacillus velezensis strain F3]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1100718 ACM9DY_RS15875 WP_003152043.1 3168140..3168280(-) (degQ) [Bacillus velezensis strain F3]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment