Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACMS1Y_RS15115 Genome accession   NZ_CP181431
Coordinates   2928761..2928901 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain BS22LVI     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2923761..2933901
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACMS1Y_RS15090 - 2924020..2924409 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  ACMS1Y_RS15095 comA 2924433..2925074 (-) 642 WP_024423322.1 response regulator transcription factor Regulator
  ACMS1Y_RS15100 - 2925155..2927468 (-) 2314 Protein_2915 ATP-binding protein -
  ACMS1Y_RS15105 - 2927531..2927698 (-) 168 WP_080696376.1 competence pheromone ComX -
  ACMS1Y_RS15110 - 2927695..2928609 (-) 915 WP_025094184.1 polyprenyl synthetase family protein -
  ACMS1Y_RS15115 degQ 2928761..2928901 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  ACMS1Y_RS15120 - 2929407..2929763 (+) 357 WP_024425946.1 hypothetical protein -
  ACMS1Y_RS15125 - 2929799..2931025 (-) 1227 WP_415316350.1 EAL and HDOD domain-containing protein -
  ACMS1Y_RS15130 - 2931162..2932634 (-) 1473 WP_024423327.1 nicotinate phosphoribosyltransferase -
  ACMS1Y_RS15135 - 2932652..2933203 (-) 552 WP_024423328.1 cysteine hydrolase family protein -
  ACMS1Y_RS15140 - 2933264..2933671 (-) 408 WP_024423329.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1100115 ACMS1Y_RS15115 WP_003213123.1 2928761..2928901(-) (degQ) [Bacillus safensis strain BS22LVI]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1100115 ACMS1Y_RS15115 WP_003213123.1 2928761..2928901(-) (degQ) [Bacillus safensis strain BS22LVI]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment