Detailed information    

insolico Bioinformatically predicted

Overview


Name   comZ   Type   Regulator
Locus tag   ACLQ7P_RS06360 Genome accession   NZ_CP181322
Coordinates   1266275..1266466 (+) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis strain JCK-1398     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context


Location: 1261275..1271466
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLQ7P_RS06330 (ACLQ7P_06330) argF 1262139..1263098 (+) 960 WP_326122629.1 ornithine carbamoyltransferase -
  ACLQ7P_RS06335 (ACLQ7P_06335) yjzC 1263183..1263362 (+) 180 WP_003245356.1 YjzC family protein -
  ACLQ7P_RS06340 (ACLQ7P_06340) yjzD 1263409..1263594 (-) 186 WP_003245236.1 YjzD family protein -
  ACLQ7P_RS06345 (ACLQ7P_06345) - 1263843..1264577 (+) 735 WP_041340422.1 hypothetical protein -
  ACLQ7P_RS06350 (ACLQ7P_06350) - 1264659..1265216 (+) 558 WP_017695676.1 hypothetical protein -
  ACLQ7P_RS06355 (ACLQ7P_06355) med 1265307..1266260 (+) 954 WP_041340417.1 transcriptional regulator Med Regulator
  ACLQ7P_RS06360 (ACLQ7P_06360) comZ 1266275..1266466 (+) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  ACLQ7P_RS06365 (ACLQ7P_06365) yjzB 1266496..1266735 (-) 240 WP_003232972.1 spore coat protein YjzB -
  ACLQ7P_RS06370 (ACLQ7P_06370) fabH 1266900..1267838 (+) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  ACLQ7P_RS06375 (ACLQ7P_06375) fabF 1267861..1269102 (+) 1242 WP_326069348.1 beta-ketoacyl-ACP synthase II -
  ACLQ7P_RS06380 (ACLQ7P_06380) yjaZ 1269178..1269963 (+) 786 WP_003232967.1 DUF2268 domain-containing protein -
  ACLQ7P_RS06385 (ACLQ7P_06385) appD 1270154..1271140 (+) 987 WP_003232965.1 oligopeptide ABC transporter ATP-binding protein AppD -

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=1099684 ACLQ7P_RS06360 WP_003224559.1 1266275..1266466(+) (comZ) [Bacillus subtilis subsp. subtilis strain JCK-1398]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=1099684 ACLQ7P_RS06360 WP_003224559.1 1266275..1266466(+) (comZ) [Bacillus subtilis subsp. subtilis strain JCK-1398]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAGTCTGAAACAGAATAA

Domains


Predicted by InterproScan.

(4-58)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment