Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   ABXG87_RS08405 Genome accession   NZ_AP031488
Coordinates   1792174..1792332 (-) Length   52 a.a.
NCBI ID   WP_073688425.1    Uniprot ID   -
Organism   Streptococcus salivarius strain NBRC 13956     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 1791106..1810548 1792174..1792332 within 0


Gene organization within MGE regions


Location: 1791106..1810548
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABXG87_RS08395 (Ssa13956_15970) - 1791106..1791402 (-) 297 WP_353551474.1 bacteriocin immunity protein -
  ABXG87_RS08400 - 1791770..1792162 (-) 393 WP_003094909.1 hypothetical protein -
  ABXG87_RS08405 (Ssa13956_15980) cipB 1792174..1792332 (-) 159 WP_073688425.1 Blp family class II bacteriocin Regulator
  ABXG87_RS08410 (Ssa13956_15990) - 1792572..1793309 (+) 738 WP_353551475.1 response regulator transcription factor -
  ABXG87_RS08415 - 1793303..1794679 (+) 1377 WP_353551476.1 GHKL domain-containing protein -
  ABXG87_RS08420 (Ssa13956_16010) - 1794713..1794862 (-) 150 Protein_1606 ISL3 family transposase -
  ABXG87_RS08425 (Ssa13956_16020) - 1795527..1795943 (-) 417 WP_004183358.1 hypothetical protein -
  ABXG87_RS08430 - 1796463..1796864 (-) 402 WP_004183361.1 hypothetical protein -
  ABXG87_RS08435 - 1797436..1797561 (-) 126 WP_004183366.1 hypothetical protein -
  ABXG87_RS08440 (Ssa13956_16040) - 1797778..1797945 (-) 168 WP_049527516.1 hypothetical protein -
  ABXG87_RS08445 (Ssa13956_16050) - 1797961..1798140 (-) 180 WP_004183368.1 Blp family class II bacteriocin -
  ABXG87_RS08450 (Ssa13956_16060) - 1798301..1800046 (-) 1746 WP_004183369.1 ABC transporter ATP-binding protein -
  ABXG87_RS08455 (Ssa13956_16070) - 1800039..1801796 (-) 1758 WP_004183370.1 ABC transporter transmembrane domain-containing protein -
  ABXG87_RS08460 (Ssa13956_16080) - 1801860..1802306 (-) 447 WP_013991127.1 hypothetical protein -
  ABXG87_RS08465 (Ssa13956_16090) - 1802409..1802936 (-) 528 WP_004183372.1 VanZ family protein -
  ABXG87_RS08470 (Ssa13956_16100) rlmN 1802938..1804047 (-) 1110 WP_096832658.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  ABXG87_RS08475 (Ssa13956_16110) - 1804111..1804839 (-) 729 WP_045772445.1 YutD family protein -
  ABXG87_RS08480 (Ssa13956_16120) - 1804894..1806249 (-) 1356 WP_004183376.1 metallophosphatase -
  ABXG87_RS08485 (Ssa13956_16130) - 1806532..1806768 (-) 237 WP_004183378.1 Blp family class II bacteriocin -
  ABXG87_RS08490 (Ssa13956_16140) - 1806909..1808162 (-) 1254 WP_353551480.1 GHKL domain-containing protein -
  ABXG87_RS08495 (Ssa13956_16150) - 1808159..1808887 (-) 729 WP_004183381.1 LytTR family DNA-binding domain-containing protein -
  ABXG87_RS08500 (Ssa13956_16160) - 1808925..1809677 (-) 753 WP_004183383.1 membrane protein -
  ABXG87_RS08505 (Ssa13956_16170) - 1809682..1810548 (-) 867 WP_045769186.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 52 a.a.        Molecular weight: 5298.02 Da        Isoelectric Point: 3.9868

>NTDB_id=109814 ABXG87_RS08405 WP_073688425.1 1792174..1792332(-) (cipB) [Streptococcus salivarius strain NBRC 13956]
MATQTIENFNTLDLETLASVEGGRVNWERWGMCGASVAVGAAIGGGVALLGC

Nucleotide


Download         Length: 159 bp        

>NTDB_id=109814 ABXG87_RS08405 WP_073688425.1 1792174..1792332(-) (cipB) [Streptococcus salivarius strain NBRC 13956]
ATGGCAACTCAAACAATTGAAAACTTTAACACCCTCGACCTTGAAACACTTGCTAGTGTTGAAGGAGGACGAGTCAATTG
GGAACGATGGGGAATGTGTGGGGCCTCTGTCGCCGTAGGTGCAGCTATTGGAGGTGGAGTAGCCTTACTTGGCTGTTAA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(7-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

44.643

100

0.481

Multiple sequence alignment