Detailed information NTG1096818

Bioinformatically predicted

Overview

• Name: comS
• Type: Regulator
• Locus tag: ACK2OW_RS21420
• Genome accession: NZ_CP180575
• Coordinates: 4101739..4101879 (-)
• Length: 46 a.a.
• NCBI ID: WP_010886404.1
• Uniprot ID: A0AAX3RTW8
• Organism: Bacillus subtilis strain K3C
• Function: preventing the degradation of ComK (predicted from homology) Competence regulation

Genomic Context

Location: 4096739..4106879

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACK2OW_RS21410 (ACK2OW_21410)	-	4097327..4100548 (-)	3222	WP_416042714.1	amino acid adenylation domain-containing protein	-
ACK2OW_RS21415 (ACK2OW_21415)	-	4100621..4101793 (-)	1173	Protein_4232	condensation domain-containing protein	-
ACK2OW_RS21420 (ACK2OW_21420)	comS	4101739..4101879 (-)	141	WP_010886404.1	competence protein ComS	Regulator
ACK2OW_RS21425 (ACK2OW_21425)	srfAB	4101923..4105015 (-)	3093	Protein_4234	surfactin non-ribosomal peptide synthetase SrfAB	-
ACK2OW_RS21430 (ACK2OW_21430)	-	4105028..4106539 (-)	1512	Protein_4235	condensation domain-containing protein	-

Sequence

Protein

• Length: 46 a.a.
• Molecular weight: 5244.05 Da
• Isoelectric Point: 9.2422

>NTDB_id=1096818 ACK2OW_RS21420 WP_010886404.1 4101739..4101879(-) (comS) [Bacillus subtilis strain K3C]
MNRSGKHLISSIILYPRPSGECISSISLDKQTQATTSPLYFCWREK

Nucleotide

• Length: 141 bp

>NTDB_id=1096818 ACK2OW_RS21420 WP_010886404.1 4101739..4101879(-) (comS) [Bacillus subtilis strain K3C]
TTGAACCGATCAGGCAAGCATCTTATCAGCAGCATTATCCTGTATCCCCGGCCCAGCGGAGAATGTATATCCTCAATCAG
CTTGGACAAGCAAACACAAGCTACAACGTCCCCGCTGTACTTCTGCTGGAGGGAGAAGTAG

Domains

Predicted by InterproScan.

• Bacillus competence protein S (ComS) (1-44)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comS	Bacillus subtilis subsp. subtilis str. 168	100	100	1