Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ACK2OW_RS03345 Genome accession   NZ_CP180575
Coordinates   568578..568961 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   A0AAX3RJE0
Organism   Bacillus subtilis strain K3C     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 563578..573961
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACK2OW_RS03305 (ACK2OW_03305) sinI 564512..564685 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  ACK2OW_RS03310 (ACK2OW_03310) sinR 564719..565054 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACK2OW_RS03315 (ACK2OW_03315) tasA 565146..565931 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  ACK2OW_RS03320 (ACK2OW_03320) sipW 565996..566568 (-) 573 WP_003246088.1 signal peptidase I SipW -
  ACK2OW_RS03325 (ACK2OW_03325) tapA 566552..567313 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  ACK2OW_RS03330 (ACK2OW_03330) yqzG 567584..567910 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  ACK2OW_RS03335 (ACK2OW_03335) spoIITA 567952..568131 (-) 180 WP_014480252.1 YqzE family protein -
  ACK2OW_RS03340 (ACK2OW_03340) comGG 568203..568577 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  ACK2OW_RS03345 (ACK2OW_03345) comGF 568578..568961 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  ACK2OW_RS03350 (ACK2OW_03350) comGE 568987..569334 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene
  ACK2OW_RS03355 (ACK2OW_03355) comGD 569318..569749 (-) 432 WP_032726159.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACK2OW_RS03360 (ACK2OW_03360) comGC 569739..570035 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ACK2OW_RS03365 (ACK2OW_03365) comGB 570049..571086 (-) 1038 WP_086344083.1 comG operon protein ComGB Machinery gene
  ACK2OW_RS03370 (ACK2OW_03370) comGA 571073..572143 (-) 1071 WP_070547533.1 competence protein ComGA Machinery gene
  ACK2OW_RS03375 (ACK2OW_03375) - 572354..572551 (-) 198 WP_032726162.1 hypothetical protein -
  ACK2OW_RS03380 (ACK2OW_03380) corA 572553..573506 (-) 954 WP_072173930.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=1096745 ACK2OW_RS03345 WP_032726158.1 568578..568961(-) (comGF) [Bacillus subtilis strain K3C]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1096745 ACK2OW_RS03345 WP_032726158.1 568578..568961(-) (comGF) [Bacillus subtilis strain K3C]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTATCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATCAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCATATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992


Multiple sequence alignment